Recombinant Human ANKRD37 protein, GST-tagged
| Cat.No. : | ANKRD37-594H |
| Product Overview : | Human ANKRD37 full-length ORF ( NP_859077.1, 1 a.a. - 158 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | ANKRD37 (Ankyrin Repeat Domain 37) is a Protein Coding gene. An important paralog of this gene is ANKRD10. |
| Molecular Mass : | 43.3 kDa |
| AA Sequence : | MLLLDCNPEVDGLKHLLETGASVNAPPDPCKQSPVHLAAGSGLACFLLWQLQTGADLNQQDVLGEAPLHKAAKVGSLECLSLLVASDAQIDLCNKNGQTAEDLAWSCGFPDCAKFLTTIKCMQTIKASEHPDRNDCVAVLRQKRSLGSVENTSGKRKC |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ANKRD37 ankyrin repeat domain 37 [ Homo sapiens ] |
| Official Symbol | ANKRD37 |
| Synonyms | ANKRD37; ankyrin repeat domain 37; ankyrin repeat domain-containing protein 37; Lrp2bp; hLrp2bp; low density lipoprotein receptor-related protein binding protein; low-density lipoprotein receptor-related protein 2-binding protein; MGC111507; |
| Gene ID | 353322 |
| mRNA Refseq | NM_181726 |
| Protein Refseq | NP_859077 |
| UniProt ID | Q7Z713 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANKRD37 Products
Required fields are marked with *
My Review for All ANKRD37 Products
Required fields are marked with *




