Recombinant Human ANKRD37 protein, GST-tagged
Cat.No. : | ANKRD37-594H |
Product Overview : | Human ANKRD37 full-length ORF ( NP_859077.1, 1 a.a. - 158 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ANKRD37 (Ankyrin Repeat Domain 37) is a Protein Coding gene. An important paralog of this gene is ANKRD10. |
Molecular Mass : | 43.3 kDa |
AA Sequence : | MLLLDCNPEVDGLKHLLETGASVNAPPDPCKQSPVHLAAGSGLACFLLWQLQTGADLNQQDVLGEAPLHKAAKVGSLECLSLLVASDAQIDLCNKNGQTAEDLAWSCGFPDCAKFLTTIKCMQTIKASEHPDRNDCVAVLRQKRSLGSVENTSGKRKC |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ANKRD37 ankyrin repeat domain 37 [ Homo sapiens ] |
Official Symbol | ANKRD37 |
Synonyms | ANKRD37; ankyrin repeat domain 37; ankyrin repeat domain-containing protein 37; Lrp2bp; hLrp2bp; low density lipoprotein receptor-related protein binding protein; low-density lipoprotein receptor-related protein 2-binding protein; MGC111507; |
Gene ID | 353322 |
mRNA Refseq | NM_181726 |
Protein Refseq | NP_859077 |
UniProt ID | Q7Z713 |
◆ Recombinant Proteins | ||
ANKRD37-2578H | Recombinant Human ANKRD37 protein, His-tagged | +Inquiry |
ANKRD37-594H | Recombinant Human ANKRD37 protein, GST-tagged | +Inquiry |
ANKRD37-376H | Recombinant Human ANKRD37 Protein, His-tagged | +Inquiry |
ANKRD37-6471H | Recombinant Human ANKRD37 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ANKRD37-1673M | Recombinant Mouse ANKRD37 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANKRD37-8851HCL | Recombinant Human ANKRD37 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANKRD37 Products
Required fields are marked with *
My Review for All ANKRD37 Products
Required fields are marked with *