Recombinant Human ANKRD45 protein, GST-tagged

Cat.No. : ANKRD45-600H
Product Overview : Human ANKRD45 full-length ORF ( NP_940895.1, 1 a.a. - 266 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ANKRD45 (Ankyrin Repeat Domain 45) is a Protein Coding gene.
Molecular Mass : 56.4 kDa
AA Sequence : MESEGPPESESSEFFSQQEEENEEEEAQEPEETGPKNPLLQPALTGDVEGLQKIFEDPENPHHEQAMQLLLEEDIVGRNLLYAACMAGQSDVIRALAKYGVNLNEKTTRGYTLLHCAAAWGRLETLKALVELDVDIEALNFREERARDVAARYSQTECVEFLDWADARLTLKKYIAKVSLAVTDTEKGSGKLLKEDKNTILSACRAKNEWLETHTEASINELFEQRQQLEDIVTPIFTKMTTPCQVKSAKSVTSHDQKRSQDDTSN
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ANKRD45 ankyrin repeat domain 45 [ Homo sapiens ]
Official Symbol ANKRD45
Synonyms ANKRD45; ankyrin repeat domain 45; ankyrin repeat domain-containing protein 45; cancer/testis antigen 117; CT117; FLJ45235; RP3-436N22.4; MGC161631; MGC161633;
Gene ID 339416
mRNA Refseq NM_198493
Protein Refseq NP_940895
UniProt ID Q5TZF3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ANKRD45 Products

Required fields are marked with *

My Review for All ANKRD45 Products

Required fields are marked with *

0
cart-icon
0
compare icon