Recombinant Human ANKRD45 protein, GST-tagged
| Cat.No. : | ANKRD45-600H |
| Product Overview : | Human ANKRD45 full-length ORF ( NP_940895.1, 1 a.a. - 266 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | ANKRD45 (Ankyrin Repeat Domain 45) is a Protein Coding gene. |
| Molecular Mass : | 56.4 kDa |
| AA Sequence : | MESEGPPESESSEFFSQQEEENEEEEAQEPEETGPKNPLLQPALTGDVEGLQKIFEDPENPHHEQAMQLLLEEDIVGRNLLYAACMAGQSDVIRALAKYGVNLNEKTTRGYTLLHCAAAWGRLETLKALVELDVDIEALNFREERARDVAARYSQTECVEFLDWADARLTLKKYIAKVSLAVTDTEKGSGKLLKEDKNTILSACRAKNEWLETHTEASINELFEQRQQLEDIVTPIFTKMTTPCQVKSAKSVTSHDQKRSQDDTSN |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ANKRD45 ankyrin repeat domain 45 [ Homo sapiens ] |
| Official Symbol | ANKRD45 |
| Synonyms | ANKRD45; ankyrin repeat domain 45; ankyrin repeat domain-containing protein 45; cancer/testis antigen 117; CT117; FLJ45235; RP3-436N22.4; MGC161631; MGC161633; |
| Gene ID | 339416 |
| mRNA Refseq | NM_198493 |
| Protein Refseq | NP_940895 |
| UniProt ID | Q5TZF3 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANKRD45 Products
Required fields are marked with *
My Review for All ANKRD45 Products
Required fields are marked with *



