Recombinant Human ANKS6 protein, GST-tagged
Cat.No. : | ANKS6-614H |
Product Overview : | Human ANKS6 full-length ORF ( AAH64367.1, 1 a.a. - 471 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein containing multiple ankyrin repeats and a SAM domain. It is thought that this protein may localize to the proximal region of the primary cilium, and may play a role in renal and cardiovascular development. Mutations in this gene have been shown to cause a form of nephronophthisis (NPHP16), a chronic tubulo-interstitial nephritis. [provided by RefSeq, Jul 2015] |
Molecular Mass : | 76.4 kDa |
AA Sequence : | MLLNDPDTELVRLLASVCMQVNKDKGRPSHQPPLPHSKVRQPWSIPVLPDDKGGLKSWWNRMSNRFRKLKLMQTLPRGLSSNQPLPFSDEPEPALDSTMRAAPQDKTSRSALPDAAPVTKDNGPGSTRGEKEDTLLTTMLRNGAPLTRLPSDKLKAVIPPFLPPSSFELWSSDRSRTRHNGKADPMKTALPQRASRGHPVGGGGTDTTPVRPVKFPSLPRSPASSANSGNFNHSPHSSGGSSGIGVSRHGGELLNRSGGSIDNVLSQIAAQRKKAAGLLEQKPSHRSSPVGPAPGSSPSELPASPAGGSAPVGKKLETSKRPPSGTSTTSKSTSPTLTPSPSPKGHTAESSVSSSSSHRQSKSSGGSSSGTITDEDELTGILKKLSLEKYQPIFEEQEVDMEAFLTLTDGDLKELGIKTDGSRQQILAAISELNAGKGRERQILQETIHNFHSSFESSASNTRAPGNSPCA |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ANKS6 ankyrin repeat and sterile alpha motif domain containing 6 [ Homo sapiens ] |
Official Symbol | ANKS6 |
Synonyms | SAMD6; ANKRD14 |
Gene ID | 203286 |
mRNA Refseq | NM_173551.3 |
Protein Refseq | NP_775822.3 |
UniProt ID | Q68DC2 |
◆ Recombinant Proteins | ||
ANKS6-1217H | Recombinant Human ANKS6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Anks6-3471R | Recombinant Rat Anks6, His-tagged | +Inquiry |
ANKS6-680R | Recombinant Rat ANKS6 Protein | +Inquiry |
ANKS6-151H | Recombinant Human ANKS6 Protein, His-tagged | +Inquiry |
ANKS6-1419HF | Recombinant Full Length Human ANKS6 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ANKS6 Products
Required fields are marked with *
My Review for All ANKS6 Products
Required fields are marked with *
0
Inquiry Basket