Recombinant Human ANO9 protein, GST-tagged
Cat.No. : | ANO9-6753H |
Product Overview : | Recombinant Human ANO9 protein(1-188 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | GST |
Protein Length : | 1-188 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | MQGEESLRILVEPEGDSFPLMEISTCETEASEQWDYVLVAQRHTQRDPRQARQQQFLEELRRKGFHIKVIRDQKQVFFGIRADNSVFGLYRTLLLEPEGPAPHAELAAPTTIPVTTSLRIRIVNFVVMNNKTSAGETFEDLMKDGVFEARFPLHKGEGRLKKTWARWRHMFREQPVDEIRNYFGEKVA |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | ANO9 anoctamin 9 [ Homo sapiens ] |
Official Symbol | ANO9 |
Synonyms | PIG5; TP53I5; TMEM16J |
mRNA Refseq | NM_001012302.2 |
Protein Refseq | NP_001012302.2 |
UniProt ID | A1A5B4 |
Gene ID | 338440 |
◆ Recombinant Proteins | ||
Ano9-3503M | Recombinant Mouse Ano9, His-tagged | +Inquiry |
ANO9-1279H | Recombinant Human ANO9 | +Inquiry |
ANO9-3291H | Recombinant Human ANO9 protein, His-tagged | +Inquiry |
ANO9-948HCL | Recombinant Human ANO9 Cell Lysate | +Inquiry |
ANO9-3502H | Recombinant Human ANO9, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANO9 Products
Required fields are marked with *
My Review for All ANO9 Products
Required fields are marked with *
0
Inquiry Basket