Recombinant Human ANP32A
| Cat.No. : | ANP32A-30006TH |
| Product Overview : | Recombinant full length Human PHAP1 expressed in Saccharomyces cerevisiae; 249 amino acids, MWt 28.6 kDa. Protein is tagged with 26 kDa proprietary tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Tag : | Non |
| Tissue specificity : | Expressed in all tissues tested. Highly expressed in kidney and skeletal muscle, moderate levels of expression in brain, placenta and pancreas, and weakly expressed in lung. Found in all regions of the brain examined (amygdala, caudate nucleus, corpus cal |
| Form : | Liquid |
| Purity : | >90% by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDE FEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSG GLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAP DSDAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDE EEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERG QKRKREPEDEGEDDD |
| Sequence Similarities : | Belongs to the ANP32 family.Contains 4 LRR (leucine-rich) repeats.Contains 1 LRRCT domain. |
| Full Length : | Full L. |
| Gene Name | ANP32A acidic (leucine-rich) nuclear phosphoprotein 32 family, member A [ Homo sapiens ] |
| Official Symbol | ANP32A |
| Synonyms | ANP32A; acidic (leucine-rich) nuclear phosphoprotein 32 family, member A; C15orf1; acidic leucine-rich nuclear phosphoprotein 32 family member A; I1PP2A; LANP; MAPM; mapmodulin; PHAPI; PP32; |
| Gene ID | 8125 |
| mRNA Refseq | NM_006305 |
| Protein Refseq | NP_006296 |
| MIM | 600832 |
| Uniprot ID | P39687 |
| Chromosome Location | 15q23 |
| Pathway | Metabolism, organism-specific biosystem; Metabolism of RNA, organism-specific biosystem; Metabolism of mRNA, organism-specific biosystem; Regulation of mRNA Stability by Proteins that Bind AU-rich Elements, organism-specific biosystem; Stabilization of mRNA by HuR, organism-specific biosystem; |
| Function | protein binding; |
| ◆ Recombinant Proteins | ||
| ANP32A-3944H | Recombinant Human ANP32A protein(Glu2-Lys238), His&GST-tagged | +Inquiry |
| ANP32A-617H | Recombinant Human ANP32A protein, GST-tagged | +Inquiry |
| ANP32A-165R | Recombinant Rhesus Macaque ANP32A Protein, His (Fc)-Avi-tagged | +Inquiry |
| ANP32A-683R | Recombinant Rat ANP32A Protein | +Inquiry |
| ANP32A-5466H | Recombinant Human ANP32A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ANP32A-8843HCL | Recombinant Human ANP32A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANP32A Products
Required fields are marked with *
My Review for All ANP32A Products
Required fields are marked with *
