Recombinant Human Anterior Gradient Homolog 3 (Xenopus laevis), His-tagged

Cat.No. : AGR3-4959H
Product Overview : AGR3, also known asanterior gradient protein 3 homolog precursor, is a secreted cytoplasmicprotein which is involved in metastasis induction and p53 tumour supressorinhibition. It may serve as molecular marker and potential therapeutic targetfor hormone-responsive breast tumours.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human
Tag : His
Description : Pleiotrophin andMidkine are structurally related heparin-binding neurotrophic factors, whoseexpression is developmentally regulated. The expression pattern of theseneurotrophic factors suggests function in neurogenesis, cell migration,secondary organogenetic induction, and mesoderm epithelial interaction. Theexpression of PTN increases during the process of brain embryogenesis andreaches maximum levels at time of birth. The physiological roles of PTN andMidkine are largely unknown, but these neurotrophins have been implicated inthe pathogenesis of neuroblastomas.
Concentration : 1 mg/ml
Form : Supplied as a liquidin 20 mM Tris-HCl buffer, pH 8.0, containing 20% glycerol, 0.1 M NaCl and 1 mMDTT.
Purity : > 90% pure by SDS-PAGE
Sequence : 22-166 amino acids:MGSSHHHHHHSSGLVPRGSHMGSMIAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFYAQKSKKPLMVIHHLEDCQYSQALKKVFAQNEEIQEMAQNKFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADIAGRYSNRLYTYEPRDLPLLIENMKKALRLIQSEL
Molecular Mass : 19.5 kDa (169 aa),confirmed by MALDI-TOF.
Applications : SDS-PAGE
Storage : Store at 4 deg C forshort term storage (1/2 weeks). Aliquot and store at -20 deg C or -70 deg Cfor long term storage. Avoid repeated freeze/thaw cycles.
OfficialSymbol : AGR3
Gene Name AGR3 anterior gradient homolog3 (Xenopus laevis) [ Homo sapiens ]
Synonyms AGR3; anteriorgradient homolog 3 (Xenopus laevis); HAG3; hAG-3; BCMP11; PDIA18; anteriorgradient protein 3 homolog; anterior gradient protein 3 homolog; AG-3;OTTHUMP00000158512; OTTHUMP00000201702; OTTHUMP00000201703; breast cancermembrane protein 11; protein disulfide isomerase family A, member 18; breastcancer membrane protein 11; AG3; Anterior gradient protein 3 homolog
Gene ID 155465
mRNA Refseq NM_176813
Protein Refseq NP_789783
MIM 609482
UniProt ID Q8TD06
Chromosome Location 7p21.1
Function alpha-dystroglycanbinding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AGR3 Products

Required fields are marked with *

My Review for All AGR3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon