Recombinant Human AOAH, GST-tagged
Cat.No. : | AOAH-150H |
Product Overview : | Human AOAH full-length ORF ( NP_001628.1, 1 a.a. - 575 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1 a.a. - 575 a.a. |
Description : | This locus encodes both the light and heavy subunits of acyloxyacyl hydrolase. The encoded enzyme catalyzes the hydrolysis of acyloxylacyl-linked fatty acyl chains from bacterial lipopolysaccharides, effectively detoxifying these molecules. The encoded protein may play a role in modulating host inflammatory response to gram-negative bacteria. Alternatively spliced transcript variants have been described. |
Molecular Mass : | 91.5 kDa |
AA Sequence : | MQSPWKILTVAPLFLLLSLQSSASPANDDQSRPSLSNGHTCVGCVLVVSVIEQLAQVHNSTVQASMERLCSYLPE KLFLKTTCYLVIDKFGSDIIKLLSADMNADVVCHTLEFCKQNTGQPLCHLYPLPKETWKFTLQKARQIVKKSPIL KYSRSGSDICSLPVLAKICQKIKLAMEQSVPFKDVDSDKYSVFPTLRGYHWRGRDCNDSDESVYPGRRPNNWDVH QDSNCNGIWGVDPKDGVPYEKKFCEGSQPRGIILLGDSAGAHFHISPEWITASQMSLNSFINLPTALTNELDWPQ LSGATGFLDSTVGIKEKSIYLRLWKRNHCNHRDYQNISRNGASSRNLKKFIESLSRNKVLDYPAIVIYAMIGNDV CSGKSDPVPAMTTPEKLYSNVMQTLKHLNSHLPNGSHVILYGLPDGTFLWDNLHNRYHPLGQLNKDMTYAQLYSF LNCLQVSPCHGWMSSNKTLRTLTSERAEQLSNTLKKIAASEKFTNFNLFYMDFAFHEIIQEWQKRGGQPWQLIEP VDGFHPNEVALLLLADHFWKKVQLQWPQILGKENPFNPQIKQVFGDQGGH |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AOAH acyloxyacyl hydrolase (neutrophil) [ Homo sapiens (human) ] |
Official Symbol | AOAH |
Synonyms | AOAH; acyloxyacyl hydrolase (neutrophil); acyloxyacyl hydrolase; EC 3.1.1.77 |
Gene ID | 313 |
mRNA Refseq | NM_001637 |
Protein Refseq | NP_001628 |
MIM | 102593 |
UniProt ID | P28039 |
Chromosome Location | 7p14-p12 |
Function | acyloxyacyl hydrolase activity; catalytic activity; lipoprotein lipase activity |
◆ Recombinant Proteins | ||
AOAH-4258H | Recombinant Human AOAH Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
AOAH-0398H | Recombinant Human AOAH Protein (Ser24-Gln300), His-tagged | +Inquiry |
AOAH-589M | Recombinant Mouse AOAH Protein, His (Fc)-Avi-tagged | +Inquiry |
AOAH-347H | Recombinant Human AOAH Protein, His (Fc)-Avi-tagged | +Inquiry |
AOAH-1722M | Recombinant Mouse AOAH Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
AOAH-8824HCL | Recombinant Human AOAH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AOAH Products
Required fields are marked with *
My Review for All AOAH Products
Required fields are marked with *
0
Inquiry Basket