Recombinant Human AP1AR Protein, GST-Tagged
| Cat.No. : | AP1AR-0056H |
| Product Overview : | Human C4orf16 full-length ORF (AAH09485.1, 1 a.a. - 269 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | AP1AR (Adaptor Related Protein Complex 1 Associated Regulatory Protein) is a Protein Coding gene. GO annotations related to this gene include kinesin binding and AP-1 adaptor complex binding. |
| Molecular Mass : | 56.9 kDa |
| AA Sequence : | MGNCCWTQCFGLLRKEAGRLQRVGGGGGSKYFRTCSRGEHLTIEFENLVESDEGESPGSSHRPLTEEEIVDLRERHYDSIAEKQKDLDKKIQKEQERQRIVQQYHPSNNGEYQSSGPEDDFESCLRNMKSQYEVFRSSRLSSDATVLTPNTESSCDLMTKTKSTSGNDDSTSLDLEWEDEEGMNRMLPMRERSKTEEDILRAALKYSNKETGSNPTSASDDSNGLEWENDFVSAEMDDNGNSEYSGFVNPVLELSDSGIRHSDTDQQTR |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | AP1AR adaptor-related protein complex 1 associated regulatory protein [ Homo sapiens ] |
| Official Symbol | AP1AR |
| Synonyms | 2C18; GBAR; C4orf16; PRO0971; gamma-BAR |
| Gene ID | 55435 |
| mRNA Refseq | NM_018569 |
| Protein Refseq | NP_061039 |
| MIM | 610851 |
| UniProt ID | Q63HQ0 |
| ◆ Recombinant Proteins | ||
| AP1AR-0056H | Recombinant Human AP1AR Protein, GST-Tagged | +Inquiry |
| AP1AR-2597HF | Recombinant Full Length Human AP1AR Protein, GST-tagged | +Inquiry |
| AP1AR-2321H | Recombinant Human AP1AR, His-tagged | +Inquiry |
| AP1AR-8474Z | Recombinant Zebrafish AP1AR | +Inquiry |
| AP1AR-171R | Recombinant Rhesus Macaque AP1AR Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AP1AR-8820HCL | Recombinant Human AP1AR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AP1AR Products
Required fields are marked with *
My Review for All AP1AR Products
Required fields are marked with *
