Recombinant Human AP1G2 protein, GST-tagged

Cat.No. : AP1G2-645H
Product Overview : Human AP1G2 partial ORF ( NP_003908, 686 a.a. - 785 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Adaptins are important components of clathrin-coated vesicles transporting ligand-receptor complexes from the plasma membrane or from the trans-Golgi network to lysosomes. The adaptin family of proteins is compsed of four classes of molecules named alpha, beta-, beta prime- and gamma- adaptins. Adaptins, together with medium and small subunits, form a heterotetrameric complex called an adaptor, whose role is to promote the formation of clathrin-coated pits and vesicles. The protein encoded by this gene is a gamma-adaptin protein and it belongs to the adaptor complexes large subunits family. This protein along with the complex is thought to function at some trafficking step in the complex pathways between the trans-Golgi network and the cell surface. Several alternatively spliced transcript variants of this gene exist, but their full-length nature is not known. [provided by RefSeq, Aug 2
Molecular Mass : 36.74 kDa
AA Sequence : RPPENPALLLITITATNFSEGDVTHFICQAAVPKSLQLQLQAPSGNTVPARGGLPITQLFRILNPNKAPLRLKLRLTYDHFHQSVQEIFEVNNLPVESWQ
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AP1G2 adaptor related protein complex 1 gamma 2 subunit [ Homo sapiens (human) ]
Official Symbol AP1G2
Synonyms AP1G2 adaptor related protein complex 1 gamma 2 subunit; G2AD; AP-1 complex subunit gamma-like 2; clathrin-associated/assembly/adaptor protein, large, gamma-2; gamma2-adaptin
Gene ID 8906
mRNA Refseq NM_001282474
Protein Refseq NP_001269403
MIM 603534
UniProt ID O75843

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AP1G2 Products

Required fields are marked with *

My Review for All AP1G2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon