Recombinant Human AP1GBP1 protein, GST-tagged
| Cat.No. : | AP1GBP1-646H |
| Product Overview : | Human AP1GBP1 partial ORF ( NP_009178.3, 456 a.a. - 555 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a protein that interacts with the gamma subunit of AP1 clathrin-adaptor complex. The AP1 complex is located at the trans-Golgi network and associates specific proteins with clathrin-coated vesicles. This encoded protein may act to connect the AP1 complex to other proteins. Alternatively spliced transcript variants that encode different isoforms have been described for this gene. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | DDFQDFQDASKSGSLDDSFSDFQELPASSKTSNSQHGNSAPSLLMPLPGTKALPSMDKYAVFKGIAADKSSENTVPPGDPGDKYSAFRELEQTAENKPLG |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | SYNRG synergin, gamma [ Homo sapiens ] |
| Official Symbol | SYNRG |
| Synonyms | SYNG; AP1GBP1 |
| Gene ID | 11276 |
| mRNA Refseq | NM_198882.1 |
| Protein Refseq | NP_942583.1 |
| MIM | 607291 |
| UniProt ID | Q9UMZ2 |
| ◆ Recombinant Proteins | ||
| AP1GBP1-646H | Recombinant Human AP1GBP1 protein, GST-tagged | +Inquiry |
| SYNRG-5532R | Recombinant Rat SYNRG Protein, His (Fc)-Avi-tagged | +Inquiry |
| SYNRG-4402R | Recombinant Rhesus Macaque SYNRG Protein, His (Fc)-Avi-tagged | +Inquiry |
| SYNRG-8919M | Recombinant Mouse SYNRG Protein, His (Fc)-Avi-tagged | +Inquiry |
| SYNRG-4586R | Recombinant Rhesus monkey SYNRG Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SYNRG Products
Required fields are marked with *
My Review for All SYNRG Products
Required fields are marked with *
