Recombinant Human APC, His-tagged

Cat.No. : APC-27359TH
Product Overview : Recombinant fragment, corresponding to amino acids 2687-2843 of Human APC with N-terminal His tag; Predicted MWt 18 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 2687-2843 a.a.
Description : This gene encodes a tumor suppressor protein that acts as an antagonist of the Wnt signaling pathway. It is also involved in other processes including cell migration and adhesion, transcriptional activation, and apoptosis. Defects in this gene cause familial adenomatous polyposis (FAP), an autosomal dominant pre-malignant disease that usually progresses to malignancy. Disease-associated mutations tend to be clustered in a small region designated the mutation cluster region (MCR) and result in a truncated protein product.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 94 μl aqua dest
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium hydrogen phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SEKANPNIKDSKDNQAKQNVGNGSVPMRTVGLENRLNSFI QVDAPDQKGTEIKPGQNNPVPVSETNESSIVERTPFSS SSSSKHSSPSGTVAARVTPFNYNPSPRKSSADSTSARP SQIPTPVNNNTKKRDSKTDSTESSGTQSPKRHSGSYLVTS V
Gene Name APC adenomatous polyposis coli [ Homo sapiens ]
Official Symbol APC
Synonyms APC; adenomatous polyposis coli; adenomatosis polyposis coli; adenomatous polyposis coli protein; DP2; DP2.5; DP3; PPP1R46; protein phosphatase 1; regulatory subunit 46;
Gene ID 324
mRNA Refseq NM_000038
Protein Refseq NP_000029
MIM 611731
Uniprot ID P25054
Chromosome Location 5q21-q22
Pathway Apoptosis, organism-specific biosystem; Apoptotic cleavage of cellular proteins, organism-specific biosystem; Apoptotic executionphase, organism-specific biosystem; Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem;
Function beta-catenin binding; NOT cadherin binding; gamma-catenin binding; microtubule binding; microtubule plus-end binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All APC Products

Required fields are marked with *

My Review for All APC Products

Required fields are marked with *

0
cart-icon