Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human APC, His-tagged

Cat.No. : APC-27359TH
Product Overview : Recombinant fragment, corresponding to amino acids 2687-2843 of Human APC with N-terminal His tag; Predicted MWt 18 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes a tumor suppressor protein that acts as an antagonist of the Wnt signaling pathway. It is also involved in other processes including cell migration and adhesion, transcriptional activation, and apoptosis. Defects in this gene cause familial adenomatous polyposis (FAP), an autosomal dominant pre-malignant disease that usually progresses to malignancy. Disease-associated mutations tend to be clustered in a small region designated the mutation cluster region (MCR) and result in a truncated protein product.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 94 μl aqua dest
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium hydrogen phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SEKANPNIKDSKDNQAKQNVGNGSVPMRTVGLENRLNSFI QVDAPDQKGTEIKPGQNNPVPVSETNESSIVERTPFSS SSSSKHSSPSGTVAARVTPFNYNPSPRKSSADSTSARP SQIPTPVNNNTKKRDSKTDSTESSGTQSPKRHSGSYLVTS V
Gene Name : APC adenomatous polyposis coli [ Homo sapiens ]
Official Symbol : APC
Synonyms : APC; adenomatous polyposis coli; adenomatosis polyposis coli; adenomatous polyposis coli protein; DP2; DP2.5; DP3; PPP1R46; protein phosphatase 1; regulatory subunit 46;
Gene ID : 324
mRNA Refseq : NM_000038
Protein Refseq : NP_000029
MIM : 611731
Uniprot ID : P25054
Chromosome Location : 5q21-q22
Pathway : Apoptosis, organism-specific biosystem; Apoptotic cleavage of cellular proteins, organism-specific biosystem; Apoptotic executionphase, organism-specific biosystem; Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem;
Function : beta-catenin binding; NOT cadherin binding; gamma-catenin binding; microtubule binding; microtubule plus-end binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends