Recombinant Human APC, His-tagged
Cat.No. : | APC-27359TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 2687-2843 of Human APC with N-terminal His tag; Predicted MWt 18 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 2687-2843 a.a. |
Description : | This gene encodes a tumor suppressor protein that acts as an antagonist of the Wnt signaling pathway. It is also involved in other processes including cell migration and adhesion, transcriptional activation, and apoptosis. Defects in this gene cause familial adenomatous polyposis (FAP), an autosomal dominant pre-malignant disease that usually progresses to malignancy. Disease-associated mutations tend to be clustered in a small region designated the mutation cluster region (MCR) and result in a truncated protein product. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 94 μl aqua dest |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium hydrogen phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | SEKANPNIKDSKDNQAKQNVGNGSVPMRTVGLENRLNSFI QVDAPDQKGTEIKPGQNNPVPVSETNESSIVERTPFSS SSSSKHSSPSGTVAARVTPFNYNPSPRKSSADSTSARP SQIPTPVNNNTKKRDSKTDSTESSGTQSPKRHSGSYLVTS V |
Gene Name | APC adenomatous polyposis coli [ Homo sapiens ] |
Official Symbol | APC |
Synonyms | APC; adenomatous polyposis coli; adenomatosis polyposis coli; adenomatous polyposis coli protein; DP2; DP2.5; DP3; PPP1R46; protein phosphatase 1; regulatory subunit 46; |
Gene ID | 324 |
mRNA Refseq | NM_000038 |
Protein Refseq | NP_000029 |
MIM | 611731 |
Uniprot ID | P25054 |
Chromosome Location | 5q21-q22 |
Pathway | Apoptosis, organism-specific biosystem; Apoptotic cleavage of cellular proteins, organism-specific biosystem; Apoptotic executionphase, organism-specific biosystem; Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; |
Function | beta-catenin binding; NOT cadherin binding; gamma-catenin binding; microtubule binding; microtubule plus-end binding; |
◆ Recombinant Proteins | ||
Apc-201M | Recombinant Mouse Apc Protein, His&SUMO-tagged | +Inquiry |
APC-001H | Active Native Human Activated Protein C | +Inquiry |
Apc-3633M | Recombinant Mouse Apc protein, His&Myc-tagged | +Inquiry |
APC-12H | Recombinant Human APC protein, GST-tagged | +Inquiry |
APC-203H | Recombinant Human APC Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
APC-90HCL | Recombinant Human APC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All APC Products
Required fields are marked with *
My Review for All APC Products
Required fields are marked with *
0
Inquiry Basket