Recombinant Human API5 protein, GST-tagged
| Cat.No. : | API5-681H |
| Product Overview : | Human API5 partial ORF ( AAH17709, 400 a.a. - 504 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes an apoptosis inhibitory protein whose expression prevents apoptosis after growth factor deprivation. This protein suppresses the transcription factor E2F1-induced apoptosis and also interacts with, and negatively regulates Acinus, a nuclear factor involved in apoptotic DNA fragmentation. Its depletion enhances the cytotoxic action of the chemotherapeutic drugs. Multiple alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Aug 2011] |
| Molecular Mass : | 37.18 kDa |
| AA Sequence : | GEALKTEENKIKVVALKITNNINVLIKDLFHIPPSYKSTVTLSWKPVQKVEIGQKRASEDTTSGSPPKKSSAGPKRDARQIYNPPSGKYSSNLGNFNYERSLQGK |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | API5 apoptosis inhibitor 5 [ Homo sapiens ] |
| Official Symbol | API5 |
| Synonyms | API5; apoptosis inhibitor 5; AAC 11; AAC11; API5 like 1; API5L1; fibroblast growth factor 2 interacting factor 2; migration inducing protein MIG8; FIF; antiapoptosis clone 11 protein; migration-inducing protein MIG8; cell migration-inducing gene 8 protein; fibroblast growth factor 2-interacting factor 2; AAC-11; FLJ11587; |
| Gene ID | 8539 |
| mRNA Refseq | NM_001142930 |
| Protein Refseq | NP_001136402 |
| MIM | 609774 |
| UniProt ID | Q9BZZ5 |
| ◆ Recombinant Proteins | ||
| API5-1770M | Recombinant Mouse API5 Protein | +Inquiry |
| API5-620M | Recombinant Mouse API5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| API5-2310H | Recombinant Human API5 Protein, MYC/DDK-tagged | +Inquiry |
| API5-356R | Recombinant Rhesus monkey API5 Protein, His-tagged | +Inquiry |
| API5-1613C | Recombinant Chicken API5 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All API5 Products
Required fields are marked with *
My Review for All API5 Products
Required fields are marked with *
