Recombinant Human API5 protein, GST-tagged
Cat.No. : | API5-681H |
Product Overview : | Human API5 partial ORF ( AAH17709, 400 a.a. - 504 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes an apoptosis inhibitory protein whose expression prevents apoptosis after growth factor deprivation. This protein suppresses the transcription factor E2F1-induced apoptosis and also interacts with, and negatively regulates Acinus, a nuclear factor involved in apoptotic DNA fragmentation. Its depletion enhances the cytotoxic action of the chemotherapeutic drugs. Multiple alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Aug 2011] |
Molecular Mass : | 37.18 kDa |
AA Sequence : | GEALKTEENKIKVVALKITNNINVLIKDLFHIPPSYKSTVTLSWKPVQKVEIGQKRASEDTTSGSPPKKSSAGPKRDARQIYNPPSGKYSSNLGNFNYERSLQGK |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | API5 apoptosis inhibitor 5 [ Homo sapiens ] |
Official Symbol | API5 |
Synonyms | API5; apoptosis inhibitor 5; AAC 11; AAC11; API5 like 1; API5L1; fibroblast growth factor 2 interacting factor 2; migration inducing protein MIG8; FIF; antiapoptosis clone 11 protein; migration-inducing protein MIG8; cell migration-inducing gene 8 protein; fibroblast growth factor 2-interacting factor 2; AAC-11; FLJ11587; |
Gene ID | 8539 |
mRNA Refseq | NM_001142930 |
Protein Refseq | NP_001136402 |
MIM | 609774 |
UniProt ID | Q9BZZ5 |
◆ Recombinant Proteins | ||
API5-5743H | Recombinant Human API5 protein, His-tagged | +Inquiry |
API5-9945Z | Recombinant Zebrafish API5 | +Inquiry |
API5-185R | Recombinant Rhesus Macaque API5 Protein, His (Fc)-Avi-tagged | +Inquiry |
Api5-628M | Recombinant Mouse Api5 Protein, MYC/DDK-tagged | +Inquiry |
API5-301104H | Recombinant Human API5 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All API5 Products
Required fields are marked with *
My Review for All API5 Products
Required fields are marked with *