Recombinant Human API5 protein, GST-tagged

Cat.No. : API5-681H
Product Overview : Human API5 partial ORF ( AAH17709, 400 a.a. - 504 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes an apoptosis inhibitory protein whose expression prevents apoptosis after growth factor deprivation. This protein suppresses the transcription factor E2F1-induced apoptosis and also interacts with, and negatively regulates Acinus, a nuclear factor involved in apoptotic DNA fragmentation. Its depletion enhances the cytotoxic action of the chemotherapeutic drugs. Multiple alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Aug 2011]
Molecular Mass : 37.18 kDa
AA Sequence : GEALKTEENKIKVVALKITNNINVLIKDLFHIPPSYKSTVTLSWKPVQKVEIGQKRASEDTTSGSPPKKSSAGPKRDARQIYNPPSGKYSSNLGNFNYERSLQGK
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name API5 apoptosis inhibitor 5 [ Homo sapiens ]
Official Symbol API5
Synonyms API5; apoptosis inhibitor 5; AAC 11; AAC11; API5 like 1; API5L1; fibroblast growth factor 2 interacting factor 2; migration inducing protein MIG8; FIF; antiapoptosis clone 11 protein; migration-inducing protein MIG8; cell migration-inducing gene 8 protein; fibroblast growth factor 2-interacting factor 2; AAC-11; FLJ11587;
Gene ID 8539
mRNA Refseq NM_001142930
Protein Refseq NP_001136402
MIM 609774
UniProt ID Q9BZZ5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All API5 Products

Required fields are marked with *

My Review for All API5 Products

Required fields are marked with *

0
cart-icon
0
compare icon