Recombinant Human APLN protein, GST-tagged
| Cat.No. : | APLN-685H |
| Product Overview : | Human APLN full-length ORF ( AAH21104, 1 a.a. - 77 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a peptide that functions as an endogenous ligand for the G-protein coupled apelin receptor. The encoded preproprotein is proteolytically processed into biologically active C-terminal peptide fragments. These peptide fragments activate different tissue specific signaling pathways that regulate diverse biological functions including fluid homeostasis, cardiovascular function and insulin secretion. This protein also functions as a coreceptor for the human immunodeficiency virus 1. [provided by RefSeq, Feb 2016] |
| Molecular Mass : | 34.1 kDa |
| AA Sequence : | MNLRLCVQALLLLWLSLTAVCGGSLMPLPDGNGLEDGNVRHLVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | APLN apelin [ Homo sapiens ] |
| Official Symbol | APLN |
| Synonyms | APLN; apelin; apelin, AGTRL1 ligand; XNPEP2; AGTRL1 ligand; APJ endogenous ligand; APEL; |
| Gene ID | 8862 |
| mRNA Refseq | NM_017413 |
| Protein Refseq | NP_059109 |
| MIM | 300297 |
| UniProt ID | Q9ULZ1 |
| ◆ Recombinant Proteins | ||
| Apln-8264R | Recombinant Rat Apln protein, His & S-tagged | +Inquiry |
| APLN-8261H | Recombinant Human APLN protein, His-tagged | +Inquiry |
| APLN-186R | Recombinant Rhesus Macaque APLN Protein, His (Fc)-Avi-tagged | +Inquiry |
| APLN-1070HF | Recombinant Full Length Human APLN Protein, GST-tagged | +Inquiry |
| APLN-370R | Recombinant Rat APLN Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| APLN-8792HCL | Recombinant Human APLN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All APLN Products
Required fields are marked with *
My Review for All APLN Products
Required fields are marked with *
