Recombinant Human APLNR Protein, GST-tagged
Cat.No. : | APLNR-449H |
Product Overview : | Human AGTRL1 full-length ORF ( AAH32688, 1 a.a. - 380 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the G protein-coupled receptor gene family. The encoded protein is related to the angiotensin receptor, but is actually an apelin receptor that inhibits adenylate cyclase activity and plays a counter-regulatory role against the pressure action of angiotensin II by exerting hypertensive effect. It functions in the cardiovascular and central nervous systems, in glucose metabolism, in embryonic and tumor angiogenesis and as a human immunodeficiency virus (HIV-1) coreceptor. Two transcript variants resulting from alternative splicing have been identified. [provided by RefSeq, Jul 2009] |
Molecular Mass : | 67.54 kDa |
AA Sequence : | MEEGGDFDNYYGADNQSECEYTDWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRSSREKRRSADIFIASLAVADLTFVVTLPLWATYTYRDYDWPFGTFFCKLSSYLIFVNMYASVFCLTGLSFDRYLAIVRPVANARLRLRVSGAVATAVLWVLAALLAMPVMVLRTTGDLENTTKVQCYMDYSMVATVSSEWAWEVGLGVSSTTVGFVVPFTIMLTCYFFIAQTIAGHFRKERIEGLRKRRRLLSIIVVLVVTFALCWMPYHLVKTLYMLGSLLHWPCDFDLFLMNIFPYCTCISYVNSCLNPFLYAFFDPRFRQACTSMLCCGQSRCAGTSHSSSGEKSASYSSGHSQGPGPNMGKGGEQMHEKSIPYSQETLVVD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | APLNR apelin receptor [ Homo sapiens ] |
Official Symbol | APLNR |
Synonyms | APLNR; apelin receptor; AGTRL1, angiotensin II receptor like 1; APJ; APJ (apelin) receptor; APJR; FLJ90771; APJ receptor; HG11 orphan receptor; angiotensin receptor-like 1; G protein-coupled receptor APJ; G-protein coupled receptor APJ; angiotensin II receptor-like 1; G-protein coupled receptor HG11; HG11; AGTRL1; FLJ96609; MGC45246; |
Gene ID | 187 |
mRNA Refseq | NM_005161 |
Protein Refseq | NP_005152 |
MIM | 600052 |
UniProt ID | P35414 |
◆ Recombinant Proteins | ||
APLNR-3550H | Recombinant Human APLNR, His-tagged | +Inquiry |
APLNR-6124H | Recombinant Human APLNR Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL-2805RF | Recombinant Full Length Rat Apelin Receptor(Aplnr) Protein, His-Tagged | +Inquiry |
APLNR-1010HF | Recombinant Full Length Human APLNR Protein, GST-tagged | +Inquiry |
APLNR-596HFL | Recombinant Full Length Human APLNR Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
APLNR-8791HCL | Recombinant Human APLNR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All APLNR Products
Required fields are marked with *
My Review for All APLNR Products
Required fields are marked with *
0
Inquiry Basket