Recombinant Human APOA1BP protein, GST-tagged
| Cat.No. : | APOA1BP-690H |
| Product Overview : | Human APOA1BP full-length ORF ( AAI00933.1, 1 a.a. - 185 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The product of this gene interacts with apolipoprotein A-I (apoA-I), the major apolipoprotein of high-density lipoproteins (HDLs). It is secreted into some bodily fluids, and its synthesis and secretion are stimulated in vitro by incubating cells with apoA-I. The human genome contains related pseudogenes. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 46.8 kDa |
| AA Sequence : | MSRSPPTVLVICGPGNNGGDGLVCARHLKLFGYEPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMPAEPMTIDELYELVVDAIFGFSFKGDVREPFHSILSVLKGLTVPIASIDIPSGWDVEKGNAGGIQPDLLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPPYPDTECVYRLQ |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | APOA1BP apolipoprotein A-I binding protein [ Homo sapiens ] |
| Official Symbol | APOA1BP |
| Synonyms | APOA1BP; apolipoprotein A-I binding protein; NAD(P)H-hydrate epimerase; AIBP; apoA I binding protein; MGC119143; MGC119144; MGC119145; YJEFN1; AI-BP; yjeF_N1; NAD(P)HX epimerase; apoA-I binding protein; apolipoprotein A-I-binding protein; yjeF N-terminal domain-containing protein 1; |
| Gene ID | 128240 |
| mRNA Refseq | NM_144772 |
| Protein Refseq | NP_658985 |
| MIM | 608862 |
| UniProt ID | Q8NCW5 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All APOA1BP Products
Required fields are marked with *
My Review for All APOA1BP Products
Required fields are marked with *



