Recombinant Human APOA1BP protein, GST-tagged
Cat.No. : | APOA1BP-690H |
Product Overview : | Human APOA1BP full-length ORF ( AAI00933.1, 1 a.a. - 185 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The product of this gene interacts with apolipoprotein A-I (apoA-I), the major apolipoprotein of high-density lipoproteins (HDLs). It is secreted into some bodily fluids, and its synthesis and secretion are stimulated in vitro by incubating cells with apoA-I. The human genome contains related pseudogenes. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 46.8 kDa |
AA Sequence : | MSRSPPTVLVICGPGNNGGDGLVCARHLKLFGYEPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMPAEPMTIDELYELVVDAIFGFSFKGDVREPFHSILSVLKGLTVPIASIDIPSGWDVEKGNAGGIQPDLLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPPYPDTECVYRLQ |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | APOA1BP apolipoprotein A-I binding protein [ Homo sapiens ] |
Official Symbol | APOA1BP |
Synonyms | APOA1BP; apolipoprotein A-I binding protein; NAD(P)H-hydrate epimerase; AIBP; apoA I binding protein; MGC119143; MGC119144; MGC119145; YJEFN1; AI-BP; yjeF_N1; NAD(P)HX epimerase; apoA-I binding protein; apolipoprotein A-I-binding protein; yjeF N-terminal domain-containing protein 1; |
Gene ID | 128240 |
mRNA Refseq | NM_144772 |
Protein Refseq | NP_658985 |
MIM | 608862 |
UniProt ID | Q8NCW5 |
◆ Recombinant Proteins | ||
APOA1BP-532H | Recombinant Human APOA1BP Protein, His-tagged | +Inquiry |
APOA1BP-731Z | Recombinant Zebrafish APOA1BP | +Inquiry |
APOA1BP-626M | Recombinant Mouse APOA1BP Protein, His (Fc)-Avi-tagged | +Inquiry |
APOA1BP-206P | Recombinant Pig APOA1BP Protein, His&GST-tagged | +Inquiry |
APOA1BP-1780M | Recombinant Mouse APOA1BP Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOA1BP-8790HCL | Recombinant Human APOA1BP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All APOA1BP Products
Required fields are marked with *
My Review for All APOA1BP Products
Required fields are marked with *