Recombinant Human APOA1BP protein, GST-tagged

Cat.No. : APOA1BP-690H
Product Overview : Human APOA1BP full-length ORF ( AAI00933.1, 1 a.a. - 185 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The product of this gene interacts with apolipoprotein A-I (apoA-I), the major apolipoprotein of high-density lipoproteins (HDLs). It is secreted into some bodily fluids, and its synthesis and secretion are stimulated in vitro by incubating cells with apoA-I. The human genome contains related pseudogenes. [provided by RefSeq, Jul 2008]
Molecular Mass : 46.8 kDa
AA Sequence : MSRSPPTVLVICGPGNNGGDGLVCARHLKLFGYEPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMPAEPMTIDELYELVVDAIFGFSFKGDVREPFHSILSVLKGLTVPIASIDIPSGWDVEKGNAGGIQPDLLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPPYPDTECVYRLQ
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name APOA1BP apolipoprotein A-I binding protein [ Homo sapiens ]
Official Symbol APOA1BP
Synonyms APOA1BP; apolipoprotein A-I binding protein; NAD(P)H-hydrate epimerase; AIBP; apoA I binding protein; MGC119143; MGC119144; MGC119145; YJEFN1; AI-BP; yjeF_N1; NAD(P)HX epimerase; apoA-I binding protein; apolipoprotein A-I-binding protein; yjeF N-terminal domain-containing protein 1;
Gene ID 128240
mRNA Refseq NM_144772
Protein Refseq NP_658985
MIM 608862
UniProt ID Q8NCW5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All APOA1BP Products

Required fields are marked with *

My Review for All APOA1BP Products

Required fields are marked with *

0
cart-icon