"APOB" Related Products

Expand
Expand

Recombinant Human APOB protein, GST-tagged

Cat.No.: APOB-128H
Product Overview: Recombinant Human APOB(28 a.a. - 127 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description: This gene product is the main apolipoprotein of chylomicrons and low density lipoproteins. It occurs in plasma as two main isoforms, apoB-48 and apoB-100: the former is synthesized exclusively in the gut and the latter in the liver. The intestinal and the hepatic forms of apoB are encoded by a single gene from a single, very long mRNA. The two isoforms share a common N-terminal sequence. The shorter apoB-48 protein is produced after RNA editing of the apoB-100 transcript at residue 2180 (CAA->UAA), resulting in the creation of a stop codon, and early translation termination. Mutations in this gene or its regulatory region cause hypobetalipoproteinemia, normotriglyceridemic hypobetalipoproteinemia, and hypercholesterolemia due to ligand-defective apoB, diseases affecting plasma cholesterol and apoB levels.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 36.74 kDa
AA Sequence: EEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEV YGFNPEGKALLKKTKNSEEFAAAMS
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: APOB apolipoprotein B (including Ag(x) antigen) [ Homo sapiens ]
Official Symbol: APOB
Synonyms: APOB; apolipoprotein B (including Ag(x) antigen); apolipoprotein B-100; apoB-48; apoB-100; apo B-100; mutant Apo B 100; apolipoprotein B48; FLDB; LDLCQ4;
Gene ID: 338
mRNA Refseq: NM_000384
Protein Refseq: NP_000375
MIM:
UniProt ID: P04114
Chromosome Location: 2p24-p23
Pathway: Cell surface interactions at the vascular wall, organism-specific biosystem; Chylomicron-mediated lipid transport, organism-specific biosystem; FOXA1 transcription factor network, organism-specific biosystem; Fat digestion and absorption, organism-specific biosystem; Fat digestion and absorption, conserved biosystem; Hemostasis, organism-specific biosystem; LDL-mediated lipid transport, organism-specific biosystem;
Function: cholesterol transporter activity; enzyme binding; heparin binding; lipid transporter activity; low-density lipoprotein particle receptor binding; phospholipid binding; protein heterodimerization activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.