Recombinant Human APOB protein, GST-tagged
Cat.No. : | APOB-128H |
Product Overview : | Recombinant Human APOB(28 a.a. - 127 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 28-127 a.a. |
Description : | This gene product is the main apolipoprotein of chylomicrons and low density lipoproteins. It occurs in plasma as two main isoforms, apoB-48 and apoB-100: the former is synthesized exclusively in the gut and the latter in the liver. The intestinal and the hepatic forms of apoB are encoded by a single gene from a single, very long mRNA. The two isoforms share a common N-terminal sequence. The shorter apoB-48 protein is produced after RNA editing of the apoB-100 transcript at residue 2180 (CAA->UAA), resulting in the creation of a stop codon, and early translation termination. Mutations in this gene or its regulatory region cause hypobetalipoproteinemia, normotriglyceridemic hypobetalipoproteinemia, and hypercholesterolemia due to ligand-defective apoB, diseases affecting plasma cholesterol and apoB levels. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | EEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEV YGFNPEGKALLKKTKNSEEFAAAMS |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | APOB apolipoprotein B (including Ag(x) antigen) [ Homo sapiens ] |
Official Symbol | APOB |
Synonyms | APOB; apolipoprotein B (including Ag(x) antigen); apolipoprotein B-100; apoB-48; apoB-100; apo B-100; mutant Apo B 100; apolipoprotein B48; FLDB; LDLCQ4; |
Gene ID | 338 |
mRNA Refseq | NM_000384 |
Protein Refseq | NP_000375 |
MIM | |
UniProt ID | P04114 |
Chromosome Location | 2p24-p23 |
Pathway | Cell surface interactions at the vascular wall, organism-specific biosystem; Chylomicron-mediated lipid transport, organism-specific biosystem; FOXA1 transcription factor network, organism-specific biosystem; Fat digestion and absorption, organism-specific biosystem; Fat digestion and absorption, conserved biosystem; Hemostasis, organism-specific biosystem; LDL-mediated lipid transport, organism-specific biosystem; |
Function | cholesterol transporter activity; enzyme binding; heparin binding; lipid transporter activity; low-density lipoprotein particle receptor binding; phospholipid binding; protein heterodimerization activity; |
◆ Recombinant Proteins | ||
Apob-494M | Recombinant Mouse Apob Protein, His-SUMO-tagged | +Inquiry |
APOB-0604H | Recombinant Human APOB Protein (Ile3374-Val3600), N-His-tagged | +Inquiry |
APOB-218C | Recombinant Cattle APOB Protein, His-tagged | +Inquiry |
APOB-1784M | Recombinant Mouse APOB Protein | +Inquiry |
APOB-3425C | Recombinant Chicken APOB | +Inquiry |
◆ Native Proteins | ||
APOB-613H | Native Human Apolipoprotein B (including Ag(x) antigen) | +Inquiry |
ApoB-3556H | Native Human ApoB | +Inquiry |
APOB-26875TH | Native Human APOB | +Inquiry |
APOB-1H | Native Human Apolipoprotein B | +Inquiry |
APOB-8037H | Native Human Plasma APOB | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All APOB Products
Required fields are marked with *
My Review for All APOB Products
Required fields are marked with *
0
Inquiry Basket