Recombinant Human APOB48R protein, GST-tagged

Cat.No. : APOB48R-694H
Product Overview : Human APOB48R partial ORF ( NP_061160, 71 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Apolipoprotein B48 receptor is a macrophage receptor that binds to the apolipoprotein B48 of dietary triglyceride (TG)-rich lipoproteins. This receptor may provide essential lipids, lipid-soluble vitamins and other nutrients to reticuloendothelial cells. If overwhelmed with elevated plasma triglyceride, the apolipoprotein B48 receptor may contribute to foam cell formation, endothelial dysfunction, and atherothrombogenesis. [provided by RefSeq, Jul 2008]
Molecular Mass : 36.74 kDa
AA Sequence : RGSQNEGAGRLRGPGDDRRHEVGSSAVEQTWGWGDGSSHGSQAERQDSGAGETAKAARCQEPSAHLEARKKSKAGSGACQDRSGQAQERQESHEQEVNRE
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name APOBR apolipoprotein B receptor [ Homo sapiens ]
Official Symbol APOBR
Synonyms APOBR; apolipoprotein B receptor; APOB48R; APOB100R; apolipoprotein B48 receptor; apolipoprotein B100 receptor; apoB-48R; apolipoprotein B-48 receptor; apolipoprotein B-100 receptor;
Gene ID 55911
mRNA Refseq NM_018690
Protein Refseq NP_061160
MIM 605220
UniProt ID Q0VD83

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All APOBR Products

Required fields are marked with *

My Review for All APOBR Products

Required fields are marked with *

0
cart-icon