Recombinant Human APOB48R protein, GST-tagged
| Cat.No. : | APOB48R-694H |
| Product Overview : | Human APOB48R partial ORF ( NP_061160, 71 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Apolipoprotein B48 receptor is a macrophage receptor that binds to the apolipoprotein B48 of dietary triglyceride (TG)-rich lipoproteins. This receptor may provide essential lipids, lipid-soluble vitamins and other nutrients to reticuloendothelial cells. If overwhelmed with elevated plasma triglyceride, the apolipoprotein B48 receptor may contribute to foam cell formation, endothelial dysfunction, and atherothrombogenesis. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | RGSQNEGAGRLRGPGDDRRHEVGSSAVEQTWGWGDGSSHGSQAERQDSGAGETAKAARCQEPSAHLEARKKSKAGSGACQDRSGQAQERQESHEQEVNRE |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | APOBR apolipoprotein B receptor [ Homo sapiens ] |
| Official Symbol | APOBR |
| Synonyms | APOBR; apolipoprotein B receptor; APOB48R; APOB100R; apolipoprotein B48 receptor; apolipoprotein B100 receptor; apoB-48R; apolipoprotein B-48 receptor; apolipoprotein B-100 receptor; |
| Gene ID | 55911 |
| mRNA Refseq | NM_018690 |
| Protein Refseq | NP_061160 |
| MIM | 605220 |
| UniProt ID | Q0VD83 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All APOBR Products
Required fields are marked with *
My Review for All APOBR Products
Required fields are marked with *
