Recombinant Human APOBEC3F protein, GST-tagged

Cat.No. : APOBEC3F-700H
Product Overview : Human APOBEC3F full-length ORF ( NP_001006667.1, 1 a.a. - 101 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]
Molecular Mass : 38.2 kDa
AA Sequence : MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPRLDAKIFRGQVPRSFIRAPFQVLSSPFGQCAPPHGTAQVQWPPQLTAGREQGRP
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name APOBEC3F apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3F [ Homo sapiens ]
Official Symbol APOBEC3F
Synonyms APOBEC3F; apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3F; DNA dC->dU-editing enzyme APOBEC-3F; ARP8; BK150C2.4.MRNA; KA6; DNA dC-> dU-editing enzyme APOBEC-3F; induced upon T-cell activation; apolipoprotein B mRNA editing enzyme cytidine deaminase; apolipoprotein B mRNA-editing enzyme catalytic polypeptide-like 3F; MGC74891;
Gene ID 200316
mRNA Refseq NM_001006666
Protein Refseq NP_001006667
MIM 608993
UniProt ID Q8IUX4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All APOBEC3F Products

Required fields are marked with *

My Review for All APOBEC3F Products

Required fields are marked with *

0
cart-icon
0
compare icon