Recombinant Human APOC4, GST-tagged

Cat.No. : APOC4-281H
Product Overview : Recombinant Human APOC4( 27 a.a. - 127 a.a.) fused with GST-tag at N-terminal, was expressed in vitro wheat germ expression system.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Wheat germ
Source : Wheat Germ
Tag : Non
Description : This gene encodes a lipid-binding protein belonging to the apolipoprotein gene family. The protein is thought to play a role in lipid metabolism. Polymorphisms in this gene may influence circulating lipid levels and may be associated with coronary artery disease risk. This gene is present in a cluster with other related apolipoprotein genes on chromosome 19. Naturally occurring read-through transcription exists between this gene and the neighboring downstream apolipoprotein C-II (APOC2) gene.
Molecular Mass : 36.85 kDa
Sequence : CQPEAQEGTLSPPPKLKMSRWSLVRGRMKELLETVVNRTRDGWQWFWSPSTFRGFMQTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLVCGDKDQG
Storagebuffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Applications : ELISA; WB
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
OfficialSymbol : APOC4
Gene Name APOC4 apolipoprotein C-IV [ Homo sapiens ]
Synonyms APOC4; apolipoprotein C-IV; apolipoprotein C4; APO-CIV; APOC-IV
Gene ID 346
mRNA Refseq NM_001646
Protein Refseq NP_001637
MIM 600745
UniProt ID P55056
Chromosome Location 19q13.2
Function lipid transporter activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All APOC4 Products

Required fields are marked with *

My Review for All APOC4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon