Recombinant Human APOC4, GST-tagged

• Cat.No.: APOC4-281H
• Product Overview: Recombinant Human APOC4( 27 a.a. - 127 a.a.) fused with GST-tag at N-terminal, was expressed in vitro wheat germ expression system.

Specification

• Species: Wheat germ
• Source: Wheat Germ
• Tag: Non
• Description: This gene encodes a lipid-binding protein belonging to the apolipoprotein gene family. The protein is thought to play a role in lipid metabolism. Polymorphisms in this gene may influence circulating lipid levels and may be associated with coronary artery disease risk. This gene is present in a cluster with other related apolipoprotein genes on chromosome 19. Naturally occurring read-through transcription exists between this gene and the neighboring downstream apolipoprotein C-II (APOC2) gene.
• Molecular Mass: 36.85 kDa
• Sequence: CQPEAQEGTLSPPPKLKMSRWSLVRGRMKELLETVVNRTRDGWQWFWSPSTFRGFMQTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLVCGDKDQG
• Storagebuffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Applications: ELISA; WB
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• OfficialSymbol: APOC4

Gene Information

• Gene Name: APOC4 apolipoprotein C-IV [ Homo sapiens ]
• Synonyms: APOC4; apolipoprotein C-IV; apolipoprotein C4; APO-CIV; APOC-IV
• Gene ID: 346
• mRNA Refseq: NM_001646
• Protein Refseq: NP_001637
• MIM: 600745
• UniProt ID: P55056
• Chromosome Location: 19q13.2
• Function: lipid transporter activity