Recombinant Human APOC4, GST-tagged
| Cat.No. : | APOC4-281H |
| Product Overview : | Recombinant Human APOC4( 27 a.a. - 127 a.a.) fused with GST-tag at N-terminal, was expressed in vitro wheat germ expression system. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Wheat germ |
| Source : | Wheat Germ |
| Tag : | Non |
| Description : | This gene encodes a lipid-binding protein belonging to the apolipoprotein gene family. The protein is thought to play a role in lipid metabolism. Polymorphisms in this gene may influence circulating lipid levels and may be associated with coronary artery disease risk. This gene is present in a cluster with other related apolipoprotein genes on chromosome 19. Naturally occurring read-through transcription exists between this gene and the neighboring downstream apolipoprotein C-II (APOC2) gene. |
| Molecular Mass : | 36.85 kDa |
| Sequence : | CQPEAQEGTLSPPPKLKMSRWSLVRGRMKELLETVVNRTRDGWQWFWSPSTFRGFMQTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLVCGDKDQG |
| Storagebuffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Applications : | ELISA; WB |
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| OfficialSymbol : | APOC4 |
| Gene Name | APOC4 apolipoprotein C-IV [ Homo sapiens ] |
| Synonyms | APOC4; apolipoprotein C-IV; apolipoprotein C4; APO-CIV; APOC-IV |
| Gene ID | 346 |
| mRNA Refseq | NM_001646 |
| Protein Refseq | NP_001637 |
| MIM | 600745 |
| UniProt ID | P55056 |
| Chromosome Location | 19q13.2 |
| Function | lipid transporter activity |
| ◆ Recombinant Proteins | ||
| APOC4-224H | Recombinant Human APOC4 Protein, His-tagged | +Inquiry |
| APOC4-636M | Recombinant Mouse APOC4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| APOC4-380R | Recombinant Rat APOC4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| APOC4-10HFL | Recombinant Human APOC4 Protein, GST tagged | +Inquiry |
| Apoc4-223R | Recombinant Rat Apoc4 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| APOC4-98HCL | Recombinant Human APOC4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All APOC4 Products
Required fields are marked with *
My Review for All APOC4 Products
Required fields are marked with *



