Recombinant Human APOC4 Protein, GST tagged
Cat.No. : | APOC4-10HFL |
Product Overview : | Human APOC4 full-length ORF ( AAH20723.1, 27 a.a.-127 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ (in vitro) |
Tag : | GST |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
AA Sequence : | CQPEAQEGTLSPPPKLKMSRWSLVRGRMKELLETVVNRTRDGWQWFWSPSTFRGFMQTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLVCGDKDQG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Official Symbol | APOC4 |
Synonyms | APOC4; apolipoprotein C-IV; apolipoprotein C4; APO-CIV; APOC-IV |
Gene ID | 346 |
mRNA Refseq | NM_001646 |
Protein Refseq | NP_001637 |
MIM | 600745 |
UniProt ID | P55056 |
◆ Recombinant Proteins | ||
APOC4-281H | Recombinant Human APOC4, GST-tagged | +Inquiry |
Apoc4-3570R | Recombinant Rat Apoc4, GST-tagged | +Inquiry |
Apoc4-1855M | Recombinant Mouse Apoc4 protein, His & GST-tagged | +Inquiry |
Apoc4-223R | Recombinant Rat Apoc4 Protein, His-tagged | +Inquiry |
APOC4-1790M | Recombinant Mouse APOC4 Protein | +Inquiry |
◆ Native Proteins | ||
APOC4-10HFL | Recombinant Human APOC4 Protein, GST tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOC4-98HCL | Recombinant Human APOC4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All APOC4 Products
Required fields are marked with *
My Review for All APOC4 Products
Required fields are marked with *