Recombinant Human APOC4 Protein, GST tagged

• Cat.No.: APOC4-10HFL
• Product Overview: Human APOC4 full-length ORF ( AAH20723.1, 27 a.a.-127 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ (in vitro)
• Tag: GST
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• AA Sequence: CQPEAQEGTLSPPPKLKMSRWSLVRGRMKELLETVVNRTRDGWQWFWSPSTFRGFMQTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLVCGDKDQG
• Applications: Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
• Notes: Best use within three months from the date of receipt of this protein.

Gene Information

• Official Symbol: APOC4
• Synonyms: APOC4; apolipoprotein C-IV; apolipoprotein C4; APO-CIV; APOC-IV
• Gene ID: 346
• mRNA Refseq: NM_001646
• Protein Refseq: NP_001637
• MIM: 600745
• UniProt ID: P55056