Recombinant Human APOD protein, His-tagged
Cat.No. : | APOD-3645H |
Product Overview : | Recombinant Human APOD protein(14-189 aa), fused to His tag, was expressed in E. coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 14-189 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | LFGAAEGQAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLS |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | APOD apolipoprotein D [ Homo sapiens ] |
Official Symbol | APOD |
Synonyms | APOD; apolipoprotein D; apo-D; |
Gene ID | 347 |
mRNA Refseq | NM_001647 |
Protein Refseq | NP_001638 |
MIM | 107740 |
UniProt ID | P05090 |
◆ Recombinant Proteins | ||
APOD-3653H | Recombinant Human APOD, His-tagged | +Inquiry |
APOD-3645H | Recombinant Human APOD protein, His-tagged | +Inquiry |
Apod-2042R | Recombinant Rat Apod protein, His-tagged | +Inquiry |
APOD-381R | Recombinant Rat APOD Protein, His (Fc)-Avi-tagged | +Inquiry |
APOD-0298H | Recombinant Human APOD Protein (Glu21-Ser189), C-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOD-8781HCL | Recombinant Human APOD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All APOD Products
Required fields are marked with *
My Review for All APOD Products
Required fields are marked with *
0
Inquiry Basket