Recombinant Human APOLD1 protein, GST-tagged

Cat.No. : APOLD1-717H
Product Overview : Human APOLD1 full-length ORF (BAG37017.1, 1 a.a. - 248 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : APOLD1 is an endothelial cell early response protein that may play a role in regulation of endothelial cell signaling and vascular function (Regard et al., 2004 [PubMed 15102925]).[supplied by OMIM, Dec 2008]
Molecular Mass : 53.68 kDa
AA Sequence : MGMERPAAREPHGPDALRRFQGLLLDRRGRLHGQVLRLREVARRLERLRRRSLVANVAGSSLSATGALAAIVGLSLSPVTLGTSLLVSAVGLGVATAGGAVTITSDLSLIFCNSRELRRVQEIAATCQDQMREILSCLEFFCRWQGCGDRQLLQCGRNASIALYNSVYFIVFFGSRGFLIPRRAEGDTKVSQAVLKAKIQKLAESLESCTGALDELSEQLESRVQLCTKSSRGHDLKISADQRAGLFF
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name APOLD1 apolipoprotein L domain containing 1 [ Homo sapiens ]
Official Symbol APOLD1
Synonyms APOLD1; apolipoprotein L domain containing 1; apolipoprotein L domain-containing protein 1; DKFZP434F0318; FLJ25138; vascular early response gene protein; VERGE; FLJ95166; DKFZp434F0318;
Gene ID 81575
mRNA Refseq NM_001130415
Protein Refseq NP_001123887
MIM 612456
UniProt ID Q96LR9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All APOLD1 Products

Required fields are marked with *

My Review for All APOLD1 Products

Required fields are marked with *

0
cart-icon
0
compare icon