Recombinant Human APRT protein, GST-tagged
Cat.No. : | APRT-729H |
Product Overview : | Human APRT full-length ORF ( NP_000476.1, 1 a.a. - 180 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Adenine phosphoribosyltransferase belongs to the purine/pyrimidine phosphoribosyltransferase family. A conserved feature of this gene is the distribution of CpG dinucleotides. This enzyme catalyzes the formation of AMP and inorganic pyrophosphate from adenine and 5-phosphoribosyl-1-pyrophosphate (PRPP). It also produces adenine as a by-product of the polyamine biosynthesis pathway. A homozygous deficiency in this enzyme causes 2,8-dihydroxyadenine urolithiasis. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 46 kDa |
AA Sequence : | MADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGLDSRGFLFGPSLAQELGLGCVLIRKRGKLPGPTLWASYSLEYGKAELEIQKDALEPGQRVVVVDDLLATGGTMNAACELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQYE |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | APRT adenine phosphoribosyltransferase [ Homo sapiens ] |
Official Symbol | APRT |
Synonyms | APRT; adenine phosphoribosyltransferase; AMP diphosphorylase; AMP pyrophosphorylase; transphosphoribosidase; AMP; MGC125856; MGC125857; MGC129961; DKFZp686D13177; |
Gene ID | 353 |
mRNA Refseq | NM_000485 |
Protein Refseq | NP_000476 |
UniProt ID | P07741 |
◆ Recombinant Proteins | ||
APRT-733R | Recombinant Rat APRT Protein | +Inquiry |
APRT-1154HF | Recombinant Full Length Human APRT Protein, GST-tagged | +Inquiry |
Aprt-3152M | Recombinant Mouse Aprt, His-tagged | +Inquiry |
APRT-0592H | Recombinant Human APRT Protein (Met1-Glu180), N-His-tagged | +Inquiry |
APRT-1830H | Recombinant Human APRT protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
APRT-102HCL | Recombinant Human APRT cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All APRT Products
Required fields are marked with *
My Review for All APRT Products
Required fields are marked with *
0
Inquiry Basket