Recombinant Human APRT protein, GST-tagged
Cat.No. : | APRT-1830H |
Product Overview : | Recombinant Human APRT protein(1-180 aa), fused to GST tag, was expressed in E. coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-180 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGLDSRGFLFGPSLAQELGLGCVLIRKRGKLPGPTLWASYSLEYGKAELEIQKDALEPGQRVVVVDDLLATGGTMNAACELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQYE |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | APRT adenine phosphoribosyltransferase [ Homo sapiens ] |
Official Symbol | APRT |
Synonyms | APRT; adenine phosphoribosyltransferase; AMP diphosphorylase; AMP pyrophosphorylase; transphosphoribosidase; AMP; MGC125856; MGC125857; MGC129961; DKFZp686D13177; |
Gene ID | 353 |
mRNA Refseq | NM_000485 |
Protein Refseq | NP_000476 |
UniProt ID | P07741 |
◆ Recombinant Proteins | ||
APRT-1154HF | Recombinant Full Length Human APRT Protein, GST-tagged | +Inquiry |
APRT-10937Z | Recombinant Zebrafish APRT | +Inquiry |
APRT-8029HFL | Recombinant Full Length Human APRT protein, Flag-tagged | +Inquiry |
APRT-389R | Recombinant Rat APRT Protein, His (Fc)-Avi-tagged | +Inquiry |
APRT-132H | Recombinant Human APRT protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
APRT-102HCL | Recombinant Human APRT cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All APRT Products
Required fields are marked with *
My Review for All APRT Products
Required fields are marked with *
0
Inquiry Basket