Recombinant Human APRT protein, GST-tagged

• Cat.No.: APRT-1830H
• Product Overview: Recombinant Human APRT protein(1-180 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-180 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: MADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGLDSRGFLFGPSLAQELGLGCVLIRKRGKLPGPTLWASYSLEYGKAELEIQKDALEPGQRVVVVDDLLATGGTMNAACELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQYE
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: APRT adenine phosphoribosyltransferase [ Homo sapiens ]
• Official Symbol: APRT
• Synonyms: APRT; adenine phosphoribosyltransferase; AMP diphosphorylase; AMP pyrophosphorylase; transphosphoribosidase; AMP; MGC125856; MGC125857; MGC129961; DKFZp686D13177
• Gene ID: 353
• mRNA Refseq: NM_000485
• Protein Refseq: NP_000476
• UniProt ID: P07741