Recombinant Human APRT Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | APRT-6499H |
Product Overview : | APRT MS Standard C13 and N15-labeled recombinant protein (NP_000476) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Adenine phosphoribosyltransferase belongs to the purine/pyrimidine phosphoribosyltransferase family. A conserved feature of this gene is the distribution of CpG dinucleotides. This enzyme catalyzes the formation of AMP and inorganic pyrophosphate from adenine and 5-phosphoribosyl-1-pyrophosphate (PRPP). It also produces adenine as a by-product of the polyamine biosynthesis pathway. A homozygous deficiency in this enzyme causes 2,8-dihydroxyadenine urolithiasis. Two transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 19.6 kDa |
AA Sequence : | MADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGLDSRGFLFGPSLAQELGLGCVLIRKRGKLPGPTLWASYSLEYGKAELEIQKDALEPGQRVVVVDDLLATGGTMNAACELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQYETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | APRT adenine phosphoribosyltransferase [ Homo sapiens (human) ] |
Official Symbol | APRT |
Synonyms | APRT; adenine phosphoribosyltransferase; AMP diphosphorylase; AMP pyrophosphorylase; transphosphoribosidase; AMP; MGC125856; MGC125857; MGC129961; DKFZp686D13177; |
Gene ID | 353 |
mRNA Refseq | NM_000485 |
Protein Refseq | NP_000476 |
MIM | 102600 |
UniProt ID | P07741 |
◆ Recombinant Proteins | ||
APRT-389R | Recombinant Rat APRT Protein, His (Fc)-Avi-tagged | +Inquiry |
APRT-8029HFL | Recombinant Full Length Human APRT protein, Flag-tagged | +Inquiry |
APRT-10937Z | Recombinant Zebrafish APRT | +Inquiry |
APRT-591H | Recombinant Human APRT protein, His-tagged | +Inquiry |
APRT-1939H | Recombinant Human Adenine phosphoribosyltransferase | +Inquiry |
◆ Cell & Tissue Lysates | ||
APRT-102HCL | Recombinant Human APRT cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All APRT Products
Required fields are marked with *
My Review for All APRT Products
Required fields are marked with *