Recombinant Human AQP1 Protein, His-SUMO-tagged

• Cat.No.: AQP1-1130H
• Product Overview: Recombinant Human AQP1 Protein (220-269aa) was expressed in E. coli with N-terminal His-SUMO tag.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 220-269 a.a.
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 21.6 kDa
• AA Sequence: GALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information

• Gene Name: AQP1 aquaporin 1 (Colton blood group) [ Homo sapiens ]
• Official Symbol: AQP1
• Synonyms: AQP1; aquaporin 1 (Colton blood group); aquaporin 1 (channel forming integral protein, 28kDa) , aquaporin 1 (channel forming integral protein, 28kDa, CO blood group) , CO, Colton blood group; aquaporin-1; CHIP28; aquaporin-CHIP; Colton blood group; urine water channel; channel-like integral membrane protein, 28-kDa; water channel protein for red blood cells and kidney proximal tubule; aquaporin 1 (channel-forming integral protein, 28kDa, CO blood group); CO; AQP-CHIP; MGC26324
• Gene ID: 358
• mRNA Refseq: NM_001185060
• Protein Refseq: NP_001171989
• MIM: 107776
• UniProt ID: P29972