Recombinant Human AQP1 Protein, His-SUMO-tagged

Cat.No. : AQP1-1130H
Product Overview : Recombinant Human AQP1 Protein (220-269aa) was expressed in E. coli with N-terminal His-SUMO tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 220-269 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 21.6 kDa
AA Sequence : GALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name AQP1 aquaporin 1 (Colton blood group) [ Homo sapiens ]
Official Symbol AQP1
Synonyms AQP1; aquaporin 1 (Colton blood group); aquaporin 1 (channel forming integral protein, 28kDa) , aquaporin 1 (channel forming integral protein, 28kDa, CO blood group) , CO, Colton blood group; aquaporin-1; CHIP28; aquaporin-CHIP; Colton blood group; urine water channel; channel-like integral membrane protein, 28-kDa; water channel protein for red blood cells and kidney proximal tubule; aquaporin 1 (channel-forming integral protein, 28kDa, CO blood group); CO; AQP-CHIP; MGC26324
Gene ID 358
mRNA Refseq NM_001185060
Protein Refseq NP_001171989
MIM 107776
UniProt ID P29972

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AQP1 Products

Required fields are marked with *

My Review for All AQP1 Products

Required fields are marked with *

0
cart-icon