Recombinant Human AQP1 Protein, His-SUMO-tagged
Cat.No. : | AQP1-1130H |
Product Overview : | Recombinant Human AQP1 Protein (220-269aa) was expressed in E. coli with N-terminal His-SUMO tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 220-269 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 21.6 kDa |
AA Sequence : | GALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | AQP1 aquaporin 1 (Colton blood group) [ Homo sapiens ] |
Official Symbol | AQP1 |
Synonyms | AQP1; aquaporin 1 (Colton blood group); aquaporin 1 (channel forming integral protein, 28kDa) , aquaporin 1 (channel forming integral protein, 28kDa, CO blood group) , CO, Colton blood group; aquaporin-1; CHIP28; aquaporin-CHIP; Colton blood group; urine water channel; channel-like integral membrane protein, 28-kDa; water channel protein for red blood cells and kidney proximal tubule; aquaporin 1 (channel-forming integral protein, 28kDa, CO blood group); CO; AQP-CHIP; MGC26324 |
Gene ID | 358 |
mRNA Refseq | NM_001185060 |
Protein Refseq | NP_001171989 |
MIM | 107776 |
UniProt ID | P29972 |
◆ Recombinant Proteins | ||
AQP1-367H | Recombinant Human AQP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL-19910HF | Recombinant Full Length Human Aquaporin-1(Aqp1) (Active) Protein, His-Tagged | +Inquiry |
AQP1-1155HF | Recombinant Full Length Human AQP1 Protein, GST-tagged | +Inquiry |
RFL-8445RF | Recombinant Full Length Rat Aquaporin-1(Aqp1) Protein, His-Tagged | +Inquiry |
RFL-33528OF | Recombinant Full Length Sheep Aquaporin-1(Aqp1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AQP1-8770HCL | Recombinant Human AQP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AQP1 Products
Required fields are marked with *
My Review for All AQP1 Products
Required fields are marked with *
0
Inquiry Basket