Recombinant Human ARFIP1 protein, GST-tagged
Cat.No. : | ARFIP1-753H |
Product Overview : | Human ARFIP1 full-length ORF ( NP_001020766.1, 1 a.a. - 373 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ARFIP1 (ADP Ribosylation Factor Interacting Protein 1) is a Protein Coding gene. GO annotations related to this gene include protein domain specific binding and phosphatidylinositol-4-phosphate binding. An important paralog of this gene is ARFIP2. |
Molecular Mass : | 68.1 kDa |
AA Sequence : | MAQESPKNSAAEIPVTSNGEVDDSREHSFNRDLKHSLPSGLGLSETQITSHGFDNTKEGVIEAGAFQGSPAPPLPSVMSPSRVAASRLAQQGSDLIVPAGGQRTQTKSGPVILADEIKNPAMEKLELVRKWSLNTYKCTRQIISEKLGRGSRTVDLELEAQIDILRDNKKKYENILKLAQTLSTQLFQMVHTQRQLGDAFADLSLKSLELHEEFGYNADTQKLLAKNGETLLGAINFFIASVNTLVNKTIEDTLMTVKQYESARIEYDAYRTDLEELNLGPRDANTLPKIEQSQHLFQAHKEKYDKMRNDVSVKLKFLEENKVKVLHNQLVLFHNAIAAYFAGNQKQLEQTLKQFHIKLKTPGVDAPSWLEEQ |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ARFIP1 ADP-ribosylation factor interacting protein 1 [ Homo sapiens ] |
Official Symbol | ARFIP1 |
Synonyms | ARFIP1; ADP-ribosylation factor interacting protein 1; arfaptin-1; arfaptin 1; HSU52521; ADP-ribosylation factor-interacting protein 1; MGC117369; |
Gene ID | 27236 |
mRNA Refseq | NM_001025593 |
Protein Refseq | NP_001020764 |
MIM | 605928 |
UniProt ID | P53367 |
◆ Recombinant Proteins | ||
ARFIP1-1815H | Recombinant Human ARFIP1 protein, GST-tagged | +Inquiry |
ARFIP1-213R | Recombinant Rhesus Macaque ARFIP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARFIP1-757R | Recombinant Rat ARFIP1 Protein | +Inquiry |
ARFIP1-4574C | Recombinant Chicken ARFIP1 | +Inquiry |
ARFIP1-3619H | Recombinant Human ARFIP1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARFIP1-8751HCL | Recombinant Human ARFIP1 293 Cell Lysate | +Inquiry |
ARFIP1-8750HCL | Recombinant Human ARFIP1 293 Cell Lysate | +Inquiry |
ARFIP1-8752HCL | Recombinant Human ARFIP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARFIP1 Products
Required fields are marked with *
My Review for All ARFIP1 Products
Required fields are marked with *