Recombinant Human ARFIP1 protein, GST-tagged
| Cat.No. : | ARFIP1-753H |
| Product Overview : | Human ARFIP1 full-length ORF ( NP_001020766.1, 1 a.a. - 373 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | ARFIP1 (ADP Ribosylation Factor Interacting Protein 1) is a Protein Coding gene. GO annotations related to this gene include protein domain specific binding and phosphatidylinositol-4-phosphate binding. An important paralog of this gene is ARFIP2. |
| Molecular Mass : | 68.1 kDa |
| AA Sequence : | MAQESPKNSAAEIPVTSNGEVDDSREHSFNRDLKHSLPSGLGLSETQITSHGFDNTKEGVIEAGAFQGSPAPPLPSVMSPSRVAASRLAQQGSDLIVPAGGQRTQTKSGPVILADEIKNPAMEKLELVRKWSLNTYKCTRQIISEKLGRGSRTVDLELEAQIDILRDNKKKYENILKLAQTLSTQLFQMVHTQRQLGDAFADLSLKSLELHEEFGYNADTQKLLAKNGETLLGAINFFIASVNTLVNKTIEDTLMTVKQYESARIEYDAYRTDLEELNLGPRDANTLPKIEQSQHLFQAHKEKYDKMRNDVSVKLKFLEENKVKVLHNQLVLFHNAIAAYFAGNQKQLEQTLKQFHIKLKTPGVDAPSWLEEQ |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ARFIP1 ADP-ribosylation factor interacting protein 1 [ Homo sapiens ] |
| Official Symbol | ARFIP1 |
| Synonyms | ARFIP1; ADP-ribosylation factor interacting protein 1; arfaptin-1; arfaptin 1; HSU52521; ADP-ribosylation factor-interacting protein 1; MGC117369; |
| Gene ID | 27236 |
| mRNA Refseq | NM_001025593 |
| Protein Refseq | NP_001020764 |
| MIM | 605928 |
| UniProt ID | P53367 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARFIP1 Products
Required fields are marked with *
My Review for All ARFIP1 Products
Required fields are marked with *
