Recombinant Human ARFRP1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ARFRP1-806H |
Product Overview : | ARFRP1 MS Standard C13 and N15-labeled recombinant protein (NP_003215) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a membrane-associated GTP-ase which localizes to the plasma membrane and is related to the ADP-ribosylation factor (ARF) and ARF-like (ARL) proteins. This gene plays a role in membrane trafficking between the trans-Golgi network and endosomes. Alternatively spliced transcript variants encoding different isoforms have been identified. |
Molecular Mass : | 22.6 kDa |
AA Sequence : | MYTLLSGLYKYMFQKDEYCILILGLDNAGKTTFLEQSKTRFNKNYKGMSLSKITTTVGLNIGTVDVGKARLMFWDLGGQEELQSLWDKYYAECHGVIYVIDSTDEERLAESKQAFEKVVTSEALCGVPVLVLANKQDVETCLSIPDIKTAFSDCTSKIGRRDCLTQACSALTGKGVREGIEWMVKCVVRNVHRPPRQRDITTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ARFRP1 ADP-ribosylation factor related protein 1 [ Homo sapiens (human) ] |
Official Symbol | ARFRP1 |
Synonyms | ARFRP1; ADP-ribosylation factor related protein 1; ADP-ribosylation factor-related protein 1; ARL18; ARP; Arp1; SCG10 like-protein; ARF-related protein 1; helicase-like protein NHL; |
Gene ID | 10139 |
mRNA Refseq | NM_003224 |
Protein Refseq | NP_003215 |
MIM | 604699 |
UniProt ID | Q13795 |
◆ Recombinant Proteins | ||
ARFRP1-2091Z | Recombinant Zebrafish ARFRP1 | +Inquiry |
ARFRP1-755H | Recombinant Human ARFRP1 protein, GST-tagged | +Inquiry |
Arfrp1-1677M | Recombinant Mouse Arfrp1 Protein, Myc/DDK-tagged | +Inquiry |
ARFRP1-9809H | Recombinant Human ARFRP1, GST-tagged | +Inquiry |
ARFRP1-759R | Recombinant Rat ARFRP1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARFRP1-8748HCL | Recombinant Human ARFRP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARFRP1 Products
Required fields are marked with *
My Review for All ARFRP1 Products
Required fields are marked with *