Recombinant Human ARFRP1 protein, GST-tagged
| Cat.No. : | ARFRP1-755H |
| Product Overview : | Human ARFRP1 full-length ORF ( NP_003215, 1 a.a. - 201 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is a membrane-associated GTP-ase which localizes to the plasma membrane and is related to the ADP-ribosylation factor (ARF) and ARF-like (ARL) proteins. This gene plays a role in membrane trafficking between the trans-Golgi network and endosomes. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, May 2012] |
| Molecular Mass : | 47.74 kDa |
| AA Sequence : | MYTLLSGLYKYMFQKDEYCILILGLDNAGKTTFLEQSKTRFNKNYKGMSLSKITTTVGLNIGTVDVGKARLMFWDLGGQEELQSLWDKYYAECHGVIYVIDSTDEERLAESKQAFEKVVTSEALCGVPVLVLANKQDVETCLSIPDIKTAFSDCTSKIGRRDCLTQACSALTGKGVREGIEWMVKCVVRNVHRPPRQRDIT |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ARFRP1 ADP-ribosylation factor related protein 1 [ Homo sapiens ] |
| Official Symbol | ARFRP1 |
| Synonyms | ARFRP1; ADP-ribosylation factor related protein 1; ADP-ribosylation factor-related protein 1; ARL18; ARP; Arp1; SCG10 like-protein; ARF-related protein 1; helicase-like protein NHL; |
| Gene ID | 10139 |
| mRNA Refseq | NM_001134758 |
| Protein Refseq | NP_001128230 |
| MIM | 604699 |
| UniProt ID | Q13795 |
| ◆ Recombinant Proteins | ||
| ARFRP1-415R | Recombinant Rat ARFRP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ARFRP1-755H | Recombinant Human ARFRP1 protein, GST-tagged | +Inquiry |
| ARFRP1-1109HF | Recombinant Full Length Human ARFRP1 Protein, GST-tagged | +Inquiry |
| ARFRP1-3452H | Recombinant Human ARFRP1 protein, His-tagged | +Inquiry |
| ARFRP1-806H | Recombinant Human ARFRP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ARFRP1-8748HCL | Recombinant Human ARFRP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARFRP1 Products
Required fields are marked with *
My Review for All ARFRP1 Products
Required fields are marked with *
