Recombinant Human ARFRP1 protein, GST-tagged
Cat.No. : | ARFRP1-755H |
Product Overview : | Human ARFRP1 full-length ORF ( NP_003215, 1 a.a. - 201 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a membrane-associated GTP-ase which localizes to the plasma membrane and is related to the ADP-ribosylation factor (ARF) and ARF-like (ARL) proteins. This gene plays a role in membrane trafficking between the trans-Golgi network and endosomes. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, May 2012] |
Molecular Mass : | 47.74 kDa |
AA Sequence : | MYTLLSGLYKYMFQKDEYCILILGLDNAGKTTFLEQSKTRFNKNYKGMSLSKITTTVGLNIGTVDVGKARLMFWDLGGQEELQSLWDKYYAECHGVIYVIDSTDEERLAESKQAFEKVVTSEALCGVPVLVLANKQDVETCLSIPDIKTAFSDCTSKIGRRDCLTQACSALTGKGVREGIEWMVKCVVRNVHRPPRQRDIT |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ARFRP1 ADP-ribosylation factor related protein 1 [ Homo sapiens ] |
Official Symbol | ARFRP1 |
Synonyms | ARFRP1; ADP-ribosylation factor related protein 1; ADP-ribosylation factor-related protein 1; ARL18; ARP; Arp1; SCG10 like-protein; ARF-related protein 1; helicase-like protein NHL; |
Gene ID | 10139 |
mRNA Refseq | NM_001134758 |
Protein Refseq | NP_001128230 |
MIM | 604699 |
UniProt ID | Q13795 |
◆ Recombinant Proteins | ||
ARFRP1-3452H | Recombinant Human ARFRP1 protein, His-tagged | +Inquiry |
ARFRP1-759R | Recombinant Rat ARFRP1 Protein | +Inquiry |
ARFRP1-9809H | Recombinant Human ARFRP1, GST-tagged | +Inquiry |
ARFRP1-755H | Recombinant Human ARFRP1 protein, GST-tagged | +Inquiry |
ARFRP1-1109HF | Recombinant Full Length Human ARFRP1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARFRP1-8748HCL | Recombinant Human ARFRP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARFRP1 Products
Required fields are marked with *
My Review for All ARFRP1 Products
Required fields are marked with *
0
Inquiry Basket