Recombinant Human ARFRP1 protein, His-tagged
Cat.No. : | ARFRP1-3452H |
Product Overview : | Recombinant Human ARFRP1 protein(1-201 aa), fused to His tag, was expressed in E. coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-201 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MYTLLSGLYKYMFQKDEYCILILGLDNAGKTTFLEQSKTRFNKNYKGMSLSKITTTVGLNIGTVDVGKARLMFWDLGGQEELQSLWDKYYAECHGVIYVIDSTDEERLAESKQAFEKVVTSEALCGVPVLVLANKQDVETCLSIPDIKTAFSDCTSKIGRRDCLTQACSALTGKGVREGIEWMVKCVVRNVHRPPRQRDIT |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ARFRP1 ADP-ribosylation factor related protein 1 [ Homo sapiens ] |
Official Symbol | ARFRP1 |
Synonyms | ARFRP1; ADP-ribosylation factor related protein 1; ADP-ribosylation factor-related protein 1; ARL18; ARP; Arp1; SCG10 like-protein; ARF-related protein 1; helicase-like protein NHL; |
Gene ID | 10139 |
mRNA Refseq | NM_001134758 |
Protein Refseq | NP_001128230 |
MIM | 604699 |
UniProt ID | Q13795 |
◆ Recombinant Proteins | ||
ARFRP1-3452H | Recombinant Human ARFRP1 protein, His-tagged | +Inquiry |
ARFRP1-9809H | Recombinant Human ARFRP1, GST-tagged | +Inquiry |
ARFRP1-2091Z | Recombinant Zebrafish ARFRP1 | +Inquiry |
ARFRP1-755H | Recombinant Human ARFRP1 protein, GST-tagged | +Inquiry |
ARFRP1-1109HF | Recombinant Full Length Human ARFRP1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARFRP1-8748HCL | Recombinant Human ARFRP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARFRP1 Products
Required fields are marked with *
My Review for All ARFRP1 Products
Required fields are marked with *
0
Inquiry Basket