"ARG2" Related Products

Expand
Expand
Expand

Recombinant Human ARG2 protein, T7/His-tagged

Cat.No.: ARG2-108H
Product Overview: Recombinant human ARG2 cDNA (23-354 aa, Isoform-1, derived from BC029050) fused with 31 aa (T7/His/TEV cleavage site) at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFVHSVAVIGAPFSQGQKRKGVEHGPAAIREAGLMKRLSSLGCHLKDF GDLSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDHSLAIGTISGHARHCPDLCVVWVD AHADINTPLTTSSGNLHGQPVSFLLRELQDKVPQLPGFSWIKPCISSASIVYIGLRDVDPPEHFILKNYDIQYFS MRDIDRLGIQKVMERTFDLLIGKRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYIAEEIHNTGLLSALD LVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREGGHIVYDQLPTPSSPDESENQARVRI
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro ARG2 protein mediated arginine depletion in tumor microenviroment regulation study in various cancer cells with "ProFectin" reagent based intracellular delivery of this protein ( Note: Mitochondrial transit peptide was removed, so this recombinant ARG2 protein will be only located at cytoplasmic one after intracellular protein delivery ).2. May be used as specific protein substrate for kinase and ubiquitin (Sumo pathway) related enzyme functional screening assays.3. May be used for protein-protein interaction mapping.4. As immunogen for specific antibody production.
Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name: ARG2 arginase, type II [ Homo sapiens ]
Official Symbol: ARG2
Synonyms: ARG2; arginase, type II; arginase-2, mitochondrial; arginase 2; kidney arginase; type II arginase; nonhepatic arginase; kidney-type arginase; non-hepatic arginase; L-arginine ureahydrolase; L-arginine amidinohydrolase;
Gene ID: 384
mRNA Refseq: NM_001172
Protein Refseq: NP_001163
MIM: 107830
UniProt ID: P78540
Chromosome Location: 14q24.1
Pathway: Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Arginine and proline metabolism, organism-specific biosystem; Arginine and proline metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of amino acids and derivatives, organism-specific biosystem;
Function: arginase activity; hydrolase activity; metal ion binding; nitric-oxide synthase binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.