Recombinant Human ARG2 protein, T7/His-tagged
| Cat.No. : | ARG2-108H |
| Product Overview : | Recombinant human ARG2 cDNA (23-354 aa, Isoform-1, derived from BC029050) fused with 31 aa (T7/His/TEV cleavage site) at N-terminal was expressed in E. coli. |
| Availability | November 29, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Protein Length : | 23-354 a.a. |
| Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFVHSVAVIGAPFSQGQKRKGVEHGPAAIREAGLMKRLSSLGCHLKDF GDLSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDHSLAIGTISGHARHCPDLCVVWVD AHADINTPLTTSSGNLHGQPVSFLLRELQDKVPQLPGFSWIKPCISSASIVYIGLRDVDPPEHFILKNYDIQYFS MRDIDRLGIQKVMERTFDLLIGKRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYIAEEIHNTGLLSALD LVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREGGHIVYDQLPTPSSPDESENQARVRI |
| Purity : | >90% by SDS-PAGE |
| Applications : | 1. May be used for in vitro ARG2 protein mediated arginine depletion in tumor microenviroment regulation study in various cancer cells with "ProFectin" reagent based intracellular delivery of this protein ( Note: Mitochondrial transit peptide was removed, so this recombinant ARG2 protein will be only located at cytoplasmic one after intracellular protein delivery ).2. May be used as specific protein substrate for kinase and ubiquitin (Sumo pathway) related enzyme functional screening assays.3. May be used for protein-protein interaction mapping.4. As immunogen for specific antibody production. |
| Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
| Gene Name | ARG2 arginase, type II [ Homo sapiens ] |
| Official Symbol | ARG2 |
| Synonyms | ARG2; arginase, type II; arginase-2, mitochondrial; arginase 2; kidney arginase; type II arginase; nonhepatic arginase; kidney-type arginase; non-hepatic arginase; L-arginine ureahydrolase; L-arginine amidinohydrolase; |
| Gene ID | 384 |
| mRNA Refseq | NM_001172 |
| Protein Refseq | NP_001163 |
| MIM | 107830 |
| UniProt ID | P78540 |
| Chromosome Location | 14q24.1 |
| Pathway | Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Arginine and proline metabolism, organism-specific biosystem; Arginine and proline metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of amino acids and derivatives, organism-specific biosystem; |
| Function | arginase activity; hydrolase activity; metal ion binding; nitric-oxide synthase binding; |
| ◆ Recombinant Proteins | ||
| ARG2-1186HF | Recombinant Full Length Human ARG2 Protein, GST-tagged | +Inquiry |
| Arg2-640M | Recombinant Mouse Arg2 Protein, MYC/DDK-tagged | +Inquiry |
| ARG2-4987H | Recombinant Human ARG2 protein | +Inquiry |
| Arg2-244M | Recombinant Mouse Arg2 Protein, His-tagged | +Inquiry |
| Arg2-8244R | Recombinant Rat Arg2 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ARG2-474HKCL | Human ARG2 Knockdown Cell Lysate | +Inquiry |
| ARG2-8747HCL | Recombinant Human ARG2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARG2 Products
Required fields are marked with *
My Review for All ARG2 Products
Required fields are marked with *
