Recombinant Human ARHGAP25 protein, His-tagged
Cat.No. : | ARHGAP25-3411H |
Product Overview : | Recombinant Human ARHGAP25 protein(1-347 aa), fused to His tag, was expressed in E. coli. |
Availability | September 11, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-347 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MSLGQSACLFLSIARSRSVMTGEQMAAFHPSSTPNPLERPIKMGWLKKQRSIVKNWQQRYFVLRAQQLYYYKDEEDTKPQGCMYLPGCTIKEIATNPEEAGKFVFEIIPASWDQNRMGQDSYVLMASSQAEMEEWVKFLRRVAGTPCGAVFGQRLDETVAYEQKFGPHLVPILVEKCAEFILEHGRNEEGIFRLPGQDNLVKQLRDAFDAGERPSFDRDTDVHTVASLLKLYLRDLPEPVVPWSQYEGFLLCGQLTNADEAKAQQELMKQLSILPRDNYSLLSYICRFLHEIQLNCAVNKMSVDNLATVIGVNLIRSKVEDPAVIMRGTPQIQRVMTMMIRDHEVLF |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ARHGAP25 Rho GTPase activating protein 25 [ Homo sapiens ] |
Official Symbol | ARHGAP25 |
Synonyms | ARHGAP25; Rho GTPase activating protein 25; rho GTPase-activating protein 25; KIAA0053; rho-type GTPase-activating protein 25; KAIA0053; |
Gene ID | 9938 |
mRNA Refseq | NM_001007231 |
Protein Refseq | NP_001007232 |
MIM | 610587 |
UniProt ID | P42331 |
◆ Recombinant Proteins | ||
ARHGAP25-3411H | Recombinant Human ARHGAP25 protein, His-tagged | +Inquiry |
Arhgap25-1683M | Recombinant Mouse Arhgap25 Protein, Myc/DDK-tagged | +Inquiry |
ARHGAP25-392R | Recombinant Rhesus monkey ARHGAP25 Protein, His-tagged | +Inquiry |
ARHGAP25-221R | Recombinant Rhesus Macaque ARHGAP25 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARHGAP25-675M | Recombinant Mouse ARHGAP25 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARHGAP25-8741HCL | Recombinant Human ARHGAP25 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARHGAP25 Products
Required fields are marked with *
My Review for All ARHGAP25 Products
Required fields are marked with *