Recombinant Human ARHGAP25 protein, His-tagged
| Cat.No. : | ARHGAP25-3411H |
| Product Overview : | Recombinant Human ARHGAP25 protein(1-347 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 16, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-347 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MSLGQSACLFLSIARSRSVMTGEQMAAFHPSSTPNPLERPIKMGWLKKQRSIVKNWQQRYFVLRAQQLYYYKDEEDTKPQGCMYLPGCTIKEIATNPEEAGKFVFEIIPASWDQNRMGQDSYVLMASSQAEMEEWVKFLRRVAGTPCGAVFGQRLDETVAYEQKFGPHLVPILVEKCAEFILEHGRNEEGIFRLPGQDNLVKQLRDAFDAGERPSFDRDTDVHTVASLLKLYLRDLPEPVVPWSQYEGFLLCGQLTNADEAKAQQELMKQLSILPRDNYSLLSYICRFLHEIQLNCAVNKMSVDNLATVIGVNLIRSKVEDPAVIMRGTPQIQRVMTMMIRDHEVLF |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | ARHGAP25 Rho GTPase activating protein 25 [ Homo sapiens ] |
| Official Symbol | ARHGAP25 |
| Synonyms | ARHGAP25; Rho GTPase activating protein 25; rho GTPase-activating protein 25; KIAA0053; rho-type GTPase-activating protein 25; KAIA0053; |
| Gene ID | 9938 |
| mRNA Refseq | NM_001007231 |
| Protein Refseq | NP_001007232 |
| MIM | 610587 |
| UniProt ID | P42331 |
| ◆ Recombinant Proteins | ||
| Arhgap25-1683M | Recombinant Mouse Arhgap25 Protein, Myc/DDK-tagged | +Inquiry |
| ARHGAP25-0539H | Recombinant Human ARHGAP25 Protein (Met1-Leu458), C-His-tagged | +Inquiry |
| ARHGAP25-675M | Recombinant Mouse ARHGAP25 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ARHGAP25-6719Z | Recombinant Zebrafish ARHGAP25 | +Inquiry |
| ARHGAP25-1094HF | Recombinant Full Length Human ARHGAP25 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ARHGAP25-8741HCL | Recombinant Human ARHGAP25 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARHGAP25 Products
Required fields are marked with *
My Review for All ARHGAP25 Products
Required fields are marked with *
