Recombinant Human ARHGDIB protein, GST-tagged
Cat.No. : | ARHGDIB-775H |
Product Overview : | Human ARHGDIB full-length ORF ( AAH09200, 1 a.a. - 201 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Members of the Rho (or ARH) protein family (see MIM 165390) and other Ras-related small GTP-binding proteins (see MIM 179520) are involved in diverse cellular events, including cell signaling, proliferation, cytoskeletal organization, and secretion. The GTP-binding proteins are active only in the GTP-bound state. At least 3 classes of proteins tightly regulate cycling between the GTP-bound and GDP-bound states: GTPase-activating proteins (GAPs), guanine nucleotide-releasing factors (GRFs), and GDP-dissociation inhibitors (GDIs). The GDIs, including ARHGDIB, decrease the rate of GDP dissociation from Ras-like GTPases (summary by Scherle et al., 1993 [PubMed 8356058]).[supplied by OMIM, Dec 2010] |
Molecular Mass : | 47.85 kDa |
AA Sequence : | MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVTDPKAPNVVVTRLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWTE |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ARHGDIB Rho GDP dissociation inhibitor (GDI) beta [ Homo sapiens ] |
Official Symbol | ARHGDIB |
Synonyms | ARHGDIB; Rho GDP dissociation inhibitor (GDI) beta; GDIA2, GDID4, RAP1GN1; rho GDP-dissociation inhibitor 2; Ly GDI; RhoGDI2; Rho GDI 2; rho-GDI beta; D4; GDIA2; GDID4; LYGDI; Ly-GDI; RAP1GN1; |
Gene ID | 397 |
mRNA Refseq | NM_001175 |
Protein Refseq | NP_001166 |
MIM | 602843 |
UniProt ID | P52566 |
◆ Recombinant Proteins | ||
ARHGDIB-9829H | Recombinant Human ARHGDIB, GST-tagged | +Inquiry |
ARHGDIB-63HFL | Recombinant Full Length Human ARHGDIB Protein, C-Flag-tagged | +Inquiry |
ARHGDIB-4780C | Recombinant Chicken ARHGDIB | +Inquiry |
ARHGDIB-1277H | Recombinant Human Rho GDP Dissociation Inhibitor (GDI) Beta | +Inquiry |
ARHGDIB-1188HF | Recombinant Full Length Human ARHGDIB Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARHGDIB-8735HCL | Recombinant Human ARHGDIB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARHGDIB Products
Required fields are marked with *
My Review for All ARHGDIB Products
Required fields are marked with *
0
Inquiry Basket