Recombinant Human ARHGDIG
| Cat.No. : | ARHGDIG-26234TH |
| Product Overview : | Recombinant full length Human ARHGDIG with N-terminal proprietary tag. Predicted MW 50.86 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 225 amino acids |
| Description : | The GDP-dissociation inhibitors (GDIs) play a primary role in modulating the activation of GTPases by inhibiting the exchange of GDP for GTP. See ARHGDIB (MIM 602843). |
| Molecular Weight : | 50.860kDa inclusive of tags |
| Tissue specificity : | Primarily expressed in pancreas and brain. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MLGLDACELGAQLLELLRLALCARVLLADKEGGPPAVDEV LDEAVPEYRAPGRKSLLEIRQLDPDDRSLAKYKRVLLGPL PPAVDPSLPNVQVTRLTLLSEQAPGPVVMDLTGDLAVLKD QVFVLKEGVDYRVKISFKVHREIVSGLKCLHHTYRRGLRV DKTVYMVGSYGPSAQEYEFVTPVEEAPRGALVRGPYLVVS LFTDDDRTHHLSWEWGLCICQDWKD |
| Sequence Similarities : | Belongs to the Rho GDI family. |
| Gene Name | ARHGDIG Rho GDP dissociation inhibitor (GDI) gamma [ Homo sapiens ] |
| Official Symbol | ARHGDIG |
| Synonyms | ARHGDIG; Rho GDP dissociation inhibitor (GDI) gamma; rho GDP-dissociation inhibitor 3; RhoGDI gamma; RHOGDI 3; |
| Gene ID | 398 |
| mRNA Refseq | NM_001176 |
| Protein Refseq | NP_001167 |
| MIM | 602844 |
| Uniprot ID | Q99819 |
| Chromosome Location | 16p13.3 |
| Pathway | G13 Signaling Pathway, organism-specific biosystem; Regulation of RhoA activity, organism-specific biosystem; Rho GTPase cycle, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signaling by Rho GTPases, organism-specific biosystem; |
| Function | GTPase activator activity; Rho GDP-dissociation inhibitor activity; |
| ◆ Recombinant Proteins | ||
| ARHGDIG-26234TH | Recombinant Human ARHGDIG | +Inquiry |
| ARHGDIG-26HF | Recombinant Full Length Human ARHGDIG Protein | +Inquiry |
| ARHGDIG-9830H | Recombinant Human ARHGDIG protein, His-tagged | +Inquiry |
| ARHGDIG-776H | Recombinant Human ARHGDIG protein, GST-tagged | +Inquiry |
| ARHGDIG-617H | Recombinant Human ARHGDIG | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ARHGDIG-115HCL | Recombinant Human ARHGDIG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARHGDIG Products
Required fields are marked with *
My Review for All ARHGDIG Products
Required fields are marked with *
