Recombinant Human ARHGDIG protein, GST-tagged
| Cat.No. : | ARHGDIG-776H |
| Product Overview : | Human ARHGDIG full-length ORF ( AAH47699, 1 a.a. - 225 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The GDP-dissociation inhibitors (GDIs) play a primary role in modulating the activation of GTPases by inhibiting the exchange of GDP for GTP. See ARHGDIB (MIM 602843).[supplied by OMIM, Nov 2010] |
| Molecular Mass : | 50.49 kDa |
| AA Sequence : | MLGLDACELGAQLLELLRLALCARVLLADKEGGPPAVDEVLDEAVPEYRAPGRKSLLEIRQLDPDDRSLAKYKRVLLGPLPPAVDPSLPNVQVTRLTLLSEQAPGPVVMDLTGDLAVLKDQVFVLKEGVDYRVKISFKVHREIVSGLKCLHHTYRRGLRVDKTVYMVGSYGPSAQEYEFVTPVEEAPRGALVRGPYLVVSLFTDDDRTHHLSWEWGLCICQDWKD |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ARHGDIG Rho GDP dissociation inhibitor (GDI) gamma [ Homo sapiens ] |
| Official Symbol | ARHGDIG |
| Synonyms | ARHGDIG; Rho GDP dissociation inhibitor (GDI) gamma; rho GDP-dissociation inhibitor 3; RhoGDI gamma; RHOGDI 3; rho GDI 3; rho-GDI gamma; RHOGDI-3; |
| Gene ID | 398 |
| mRNA Refseq | NM_001176 |
| Protein Refseq | NP_001167 |
| MIM | 602844 |
| UniProt ID | Q99819 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARHGDIG Products
Required fields are marked with *
My Review for All ARHGDIG Products
Required fields are marked with *




