Recombinant Human ARHGEF38 Protein, GST-tagged
Cat.No. : | ARHGEF38-4256H |
Product Overview : | Human FLJ20184 full-length ORF (BAA90998.1, 1 a.a. - 219 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ARHGEF38 (Rho Guanine Nucleotide Exchange Factor 38) is a Protein Coding gene. Among its related pathways are p75 NTR receptor-mediated signalling and Signaling by GPCR. GO annotations related to this gene include Rho guanyl-nucleotide exchange factor activity. An important paralog of this gene is DNMBP. |
Molecular Mass : | 51.9 kDa |
AA Sequence : | MEPKEATGKENMVTKKKNLAFLRSRLYMLERRKTDTVVESSVSGDHSGTLRRSQSDRTEYNQKLQEKMTPRGECSVAETLTPEEEHHMKRMMAKREKIIKELIQTEKDYLNDLELCVREVVQPLRNKKTDRLDVDSLFSNIESVHQISAKLLSLLEEATTDVEPAMQVIGEVFLQIKGPLEDIYKIYCYHHDEAHSILESYEKEEELKEHLSHCIQSLK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ARHGEF38 Rho guanine nucleotide exchange factor 38 [ Homo sapiens (human) ] |
Official Symbol | ARHGEF38 |
Synonyms | ARHGEF38; Rho guanine nucleotide exchange factor 38; rho guanine nucleotide exchange factor 38; Rho guanine nucleotide exchange factor (GEF) 38 |
Gene ID | 54848 |
mRNA Refseq | NM_001242729 |
Protein Refseq | NP_001229658 |
UniProt ID | Q9NXL2 |
◆ Recombinant Proteins | ||
ARHGEF38-700M | Recombinant Mouse ARHGEF38 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARHGEF38-5945H | Recombinant Human ARHGEF38 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ARHGEF38-1901M | Recombinant Mouse ARHGEF38 Protein | +Inquiry |
ARHGEF38-2695H | Recombinant Human ARHGEF38 Protein, MYC/DDK-tagged | +Inquiry |
ARHGEF38-4256H | Recombinant Human ARHGEF38 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARHGEF38 Products
Required fields are marked with *
My Review for All ARHGEF38 Products
Required fields are marked with *