Recombinant Human ARHGEF38 Protein, GST-tagged

Cat.No. : ARHGEF38-4256H
Product Overview : Human FLJ20184 full-length ORF (BAA90998.1, 1 a.a. - 219 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ARHGEF38 (Rho Guanine Nucleotide Exchange Factor 38) is a Protein Coding gene. Among its related pathways are p75 NTR receptor-mediated signalling and Signaling by GPCR. GO annotations related to this gene include Rho guanyl-nucleotide exchange factor activity. An important paralog of this gene is DNMBP.
Molecular Mass : 51.9 kDa
AA Sequence : MEPKEATGKENMVTKKKNLAFLRSRLYMLERRKTDTVVESSVSGDHSGTLRRSQSDRTEYNQKLQEKMTPRGECSVAETLTPEEEHHMKRMMAKREKIIKELIQTEKDYLNDLELCVREVVQPLRNKKTDRLDVDSLFSNIESVHQISAKLLSLLEEATTDVEPAMQVIGEVFLQIKGPLEDIYKIYCYHHDEAHSILESYEKEEELKEHLSHCIQSLK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ARHGEF38 Rho guanine nucleotide exchange factor 38 [ Homo sapiens (human) ]
Official Symbol ARHGEF38
Synonyms ARHGEF38; Rho guanine nucleotide exchange factor 38; rho guanine nucleotide exchange factor 38; Rho guanine nucleotide exchange factor (GEF) 38
Gene ID 54848
mRNA Refseq NM_001242729
Protein Refseq NP_001229658
UniProt ID Q9NXL2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARHGEF38 Products

Required fields are marked with *

My Review for All ARHGEF38 Products

Required fields are marked with *

0
cart-icon
0
compare icon