Recombinant Human ARHGEF7 protein, His-tagged
| Cat.No. : | ARHGEF7-3594H |
| Product Overview : | Recombinant Human ARHGEF7 protein(42-193 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 18, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 42-193 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | CRLLERLLPGTIEKVYPEPRSESECLSNIREFLRGCGASLRLELLFPPSQPPQHLVTTILLSASTFDANDLYQGQNFNKVLSSLVTLNKVTADIGLGSDSVCARPSSHRIKSFDSLGSQSLHTRTSKLFQGQYRSLDMTDNSNNQLVVRAKF |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | ARHGEF7 Rho guanine nucleotide exchange factor (GEF) 7 [ Homo sapiens ] |
| Official Symbol | ARHGEF7 |
| Synonyms | ARHGEF7; Rho guanine nucleotide exchange factor (GEF) 7; rho guanine nucleotide exchange factor 7; BETA PIX; COOL1; DKFZp686C12170; DKFZp761K1021; guanine nucleotide exchange factor 7; KIAA0142; Nbla10314; P50; P50BP; P85; P85COOL1; P85SPR; PAK interacting exchange factor beta; PAK3; PIXB; rho; SH3 domain containing proline rich protein; PAK-interacting exchange factor beta; SH3 domain-containing proline-rich protein; COOL-1; BETA-PIX; |
| Gene ID | 8874 |
| mRNA Refseq | NM_001113511 |
| Protein Refseq | NP_001106983 |
| MIM | 605477 |
| UniProt ID | Q14155 |
| ◆ Recombinant Proteins | ||
| Arhgef7-1696M | Recombinant Mouse Arhgef7 Protein, Myc/DDK-tagged | +Inquiry |
| Arhgef7-1731R | Recombinant Rat Arhgef7 protein, His & T7-tagged | +Inquiry |
| ARHGEF7-9840H | Recombinant Human ARHGEF7, GST-tagged | +Inquiry |
| ARHGEF7-1907M | Recombinant Mouse ARHGEF7 Protein | +Inquiry |
| ARHGEF7-790H | Recombinant Human ARHGEF7 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ARHGEF7-8729HCL | Recombinant Human ARHGEF7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARHGEF7 Products
Required fields are marked with *
My Review for All ARHGEF7 Products
Required fields are marked with *
