Recombinant Human ARHGEF7 protein, His-tagged

Cat.No. : ARHGEF7-3594H
Product Overview : Recombinant Human ARHGEF7 protein(42-193 aa), fused to His tag, was expressed in E. coli.
Availability August 03, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 42-193 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : CRLLERLLPGTIEKVYPEPRSESECLSNIREFLRGCGASLRLELLFPPSQPPQHLVTTILLSASTFDANDLYQGQNFNKVLSSLVTLNKVTADIGLGSDSVCARPSSHRIKSFDSLGSQSLHTRTSKLFQGQYRSLDMTDNSNNQLVVRAKF
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name ARHGEF7 Rho guanine nucleotide exchange factor (GEF) 7 [ Homo sapiens ]
Official Symbol ARHGEF7
Synonyms ARHGEF7; Rho guanine nucleotide exchange factor (GEF) 7; rho guanine nucleotide exchange factor 7; BETA PIX; COOL1; DKFZp686C12170; DKFZp761K1021; guanine nucleotide exchange factor 7; KIAA0142; Nbla10314; P50; P50BP; P85; P85COOL1; P85SPR; PAK interacting exchange factor beta; PAK3; PIXB; rho; SH3 domain containing proline rich protein; PAK-interacting exchange factor beta; SH3 domain-containing proline-rich protein; COOL-1; BETA-PIX;
Gene ID 8874
mRNA Refseq NM_001113511
Protein Refseq NP_001106983
MIM 605477
UniProt ID Q14155

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARHGEF7 Products

Required fields are marked with *

My Review for All ARHGEF7 Products

Required fields are marked with *

0
cart-icon