Recombinant Human ARID5B protein, GST-tagged

Cat.No. : ARID5B-798H
Product Overview : Human ARID5B partial ORF (XP_084482, 1483 a.a. - 1582 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the AT-rich interaction domain (ARID) family of DNA binding proteins. The encoded protein forms a histone H3K9Me2 demethylase complex with PHD finger protein 2 and regulates the transcription of target genes involved in adipogenesis and liver development. This gene also plays a role in cell growth and differentiation of B-lymphocyte progenitors, and single nucleotide polymorphisms in this gene are associated with acute lymphoblastic leukemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Sep 2011]
Molecular Mass : 36.74 kDa
AA Sequence : SGLNSRLPAGYSHSLQYLKNQTVLSPLMQPLAFHSLVMQRGIFTSPTNSQQLYRHLAAATPVGSSYGDLLHNSIYPLAAINPQAAFPSSQLSSVHPSTKL
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ARID5B AT rich interactive domain 5B (MRF1-like) [ Homo sapiens ]
Official Symbol ARID5B
Synonyms ARID5B; AT rich interactive domain 5B (MRF1-like); AT-rich interactive domain-containing protein 5B; FLJ21150; MRF2; MRF1-like protein; ARID domain-containing protein 5B; modulator recognition factor 2 (MRF2); DESRT; MRF-2; FLJ41888;
Gene ID 84159
mRNA Refseq NM_001244638
Protein Refseq NP_001231567
MIM 608538
UniProt ID Q14865

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARID5B Products

Required fields are marked with *

My Review for All ARID5B Products

Required fields are marked with *

0
cart-icon
0
compare icon