Recombinant Human ARID5B protein, GST-tagged
Cat.No. : | ARID5B-798H |
Product Overview : | Human ARID5B partial ORF (XP_084482, 1483 a.a. - 1582 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the AT-rich interaction domain (ARID) family of DNA binding proteins. The encoded protein forms a histone H3K9Me2 demethylase complex with PHD finger protein 2 and regulates the transcription of target genes involved in adipogenesis and liver development. This gene also plays a role in cell growth and differentiation of B-lymphocyte progenitors, and single nucleotide polymorphisms in this gene are associated with acute lymphoblastic leukemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Sep 2011] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | SGLNSRLPAGYSHSLQYLKNQTVLSPLMQPLAFHSLVMQRGIFTSPTNSQQLYRHLAAATPVGSSYGDLLHNSIYPLAAINPQAAFPSSQLSSVHPSTKL |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ARID5B AT rich interactive domain 5B (MRF1-like) [ Homo sapiens ] |
Official Symbol | ARID5B |
Synonyms | ARID5B; AT rich interactive domain 5B (MRF1-like); AT-rich interactive domain-containing protein 5B; FLJ21150; MRF2; MRF1-like protein; ARID domain-containing protein 5B; modulator recognition factor 2 (MRF2); DESRT; MRF-2; FLJ41888; |
Gene ID | 84159 |
mRNA Refseq | NM_001244638 |
Protein Refseq | NP_001231567 |
MIM | 608538 |
UniProt ID | Q14865 |
◆ Recombinant Proteins | ||
ARID5B-5057Z | Recombinant Zebrafish ARID5B | +Inquiry |
ARID5B-2882C | Recombinant Chicken ARID5B | +Inquiry |
ARID5B-798H | Recombinant Human ARID5B protein, GST-tagged | +Inquiry |
ARID5B-1917M | Recombinant Mouse ARID5B Protein | +Inquiry |
ARID5B-712M | Recombinant Mouse ARID5B Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARID5B Products
Required fields are marked with *
My Review for All ARID5B Products
Required fields are marked with *
0
Inquiry Basket