Recombinant Human ARL1 protein, GST-tagged
Cat.No. : | ARL1-801H |
Product Overview : | Human ARL1 full-length ORF ( AAH07000.1, 1 a.a. - 181 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene belongs to the ARL (ADP-ribosylation factor-like) family of proteins, which are structurally related to ADP-ribosylation factors (ARFs). ARFs, described as activators of cholera toxin (CT) ADP-ribosyltransferase activity, regulate intracellular vesicular membrane trafficking, and stimulate a phospholipase D (PLD) isoform. Although, ARL proteins were initially thought not to activate CT or PLD, later work showed that they are weak stimulators of PLD and CT in a phospholipid dependent manner. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2014] |
Molecular Mass : | 45.54 kDa |
AA Sequence : | MGGFFSSIFSSLFGTREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVETVTYKNLKFQVWDLGGQTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAILVVFANKQDMEQAMTSSEMANSLGLPALKDRKWQIFKTSATKGTGLDEAMEWLVETLKSRQ |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ARL1 ADP-ribosylation factor-like 1 [ Homo sapiens ] |
Official Symbol | ARL1 |
Synonyms | ARL1; ADP-ribosylation factor-like 1; ADP-ribosylation factor-like protein 1; ARFL1; |
Gene ID | 400 |
mRNA Refseq | NM_001177 |
Protein Refseq | NP_001168 |
MIM | 603425 |
UniProt ID | P40616 |
◆ Recombinant Proteins | ||
ARL1-4200H | Recombinant Human ADP-Ribosylation Factor-Like 1, His-tagged | +Inquiry |
ARL1-714M | Recombinant Mouse ARL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARL1-801H | Recombinant Human ARL1 protein, GST-tagged | +Inquiry |
ARL1-603Z | Recombinant Zebrafish ARL1 | +Inquiry |
Arl1-256M | Recombinant Mouse Arl1 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARL1-8724HCL | Recombinant Human ARL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARL1 Products
Required fields are marked with *
My Review for All ARL1 Products
Required fields are marked with *
0
Inquiry Basket