Recombinant Human ARL16 protein, GST-tagged
Cat.No. : | ARL16-807H |
Product Overview : | Human ARL16 full-length ORF ( ADR82863.1, 1 a.a. - 197 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene belongs to the ARL (ADP-ribosylation factor-like) family of proteins, which are structurally related to ADP-ribosylation factors (ARFs). This protein has been shown to have an inhibitory role in the cellular antiviral response. This gene product interacts with the C-terminal domain of the DEXD/H-box helicase 58 (DDX58) gene product. This interaction was found to suppress the association between the DDX58 gene product and RNA, thereby negatively regulating the activity of the DDX58 gene product. [provided by RefSeq, Jul 2016] |
Molecular Mass : | 21.7 kDa |
AA Sequence : | MRVAGGRALSRGAELRVPGGAKHGMCLLLGATGVGKTLLVKRLQEVSSRDGKGDLGEPPPTRPTVGTNLTDIVAQRKITIRELGGCMGPIWSSYYGNCRSLLFVMDASDPTQLSASCVQLLGLLSAEQLAEASVLILFNKIDLPCYMSTEEMKSLIRLPDIIACAKQNITTAEISAREGTGLAGVLAWLQATHRAND |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ARL16 ADP-ribosylation factor-like 16 [ Homo sapiens ] |
Official Symbol | ARL16 |
Synonyms | ARL16; ADP-ribosylation factor-like 16; ADP-ribosylation factor-like protein 16; |
Gene ID | 339231 |
mRNA Refseq | NM_001040025 |
Protein Refseq | NP_001035114 |
UniProt ID | Q0P5N6 |
◆ Recombinant Proteins | ||
ARL16-6887H | Recombinant Human ARL16 protein, GST-tagged | +Inquiry |
ARL16-5598Z | Recombinant Zebrafish ARL16 | +Inquiry |
ARL16-807H | Recombinant Human ARL16 protein, GST-tagged | +Inquiry |
ARL16-1449HF | Recombinant Full Length Human ARL16 Protein, GST-tagged | +Inquiry |
ARL16-6888H | Recombinant Human ARL16 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARL16-8717HCL | Recombinant Human ARL16 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARL16 Products
Required fields are marked with *
My Review for All ARL16 Products
Required fields are marked with *
0
Inquiry Basket