Recombinant Human ARL4A protein, His-tagged
| Cat.No. : | ARL4A-2550H |
| Product Overview : | Recombinant Human ARL4A protein(P40617)(2-200aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 2-200aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 26.5 kDa |
| AA Sequence : | GNGLSDQTSILSNLPSFQSFHIVILGLDCAGKTTVLYRLQFNEFVNTVPTKGFNTEKIKVTLGNSKTVTFHFWDVGGQEKLRPLWKSYTRCTDGIVFVVDSVDVERMEEAKTELHKITRISENQGVPVLIVANKQDLRNSLSLSEIEKLLAMGELSSSTPWHLQPTCAIIGDGLKEGLEKLHDMIIKRRKMLRQQKKKR |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | ARL4A ADP-ribosylation factor-like 4A [ Homo sapiens ] |
| Official Symbol | ARL4A |
| Synonyms | ARL4A; ADP-ribosylation factor-like 4A; ADP ribosylation factor like 4 , ARL4; ADP-ribosylation factor-like protein 4A; ADP-ribosylation factor-like 4; ARL4; |
| Gene ID | 10124 |
| mRNA Refseq | NM_001037164 |
| Protein Refseq | NP_001032241 |
| MIM | 604786 |
| UniProt ID | P40617 |
| ◆ Recombinant Proteins | ||
| ARL4A-3602H | Recombinant Human ARL4A, His-tagged | +Inquiry |
| ARL4A-1107HF | Recombinant Full Length Human ARL4A Protein, GST-tagged | +Inquiry |
| ARL4A-783R | Recombinant Rat ARL4A Protein | +Inquiry |
| ARL4A-2550H | Recombinant Human ARL4A protein, His-tagged | +Inquiry |
| Arl4a-3215M | Recombinant Mouse Arl4a, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ARL4A-8713HCL | Recombinant Human ARL4A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARL4A Products
Required fields are marked with *
My Review for All ARL4A Products
Required fields are marked with *
