Recombinant Human ARL4A protein, His-tagged

Cat.No. : ARL4A-2550H
Product Overview : Recombinant Human ARL4A protein(P40617)(2-200aa), fused to N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 2-200aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 26.5 kDa
AA Sequence : GNGLSDQTSILSNLPSFQSFHIVILGLDCAGKTTVLYRLQFNEFVNTVPTKGFNTEKIKVTLGNSKTVTFHFWDVGGQEKLRPLWKSYTRCTDGIVFVVDSVDVERMEEAKTELHKITRISENQGVPVLIVANKQDLRNSLSLSEIEKLLAMGELSSSTPWHLQPTCAIIGDGLKEGLEKLHDMIIKRRKMLRQQKKKR
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name ARL4A ADP-ribosylation factor-like 4A [ Homo sapiens ]
Official Symbol ARL4A
Synonyms ARL4A; ADP-ribosylation factor-like 4A; ADP ribosylation factor like 4 , ARL4; ADP-ribosylation factor-like protein 4A; ADP-ribosylation factor-like 4; ARL4;
Gene ID 10124
mRNA Refseq NM_001037164
Protein Refseq NP_001032241
MIM 604786
UniProt ID P40617

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARL4A Products

Required fields are marked with *

My Review for All ARL4A Products

Required fields are marked with *

0
cart-icon