Recombinant Human ARL4A protein, His-tagged
Cat.No. : | ARL4A-2550H |
Product Overview : | Recombinant Human ARL4A protein(P40617)(2-200aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 2-200aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 26.5 kDa |
AA Sequence : | GNGLSDQTSILSNLPSFQSFHIVILGLDCAGKTTVLYRLQFNEFVNTVPTKGFNTEKIKVTLGNSKTVTFHFWDVGGQEKLRPLWKSYTRCTDGIVFVVDSVDVERMEEAKTELHKITRISENQGVPVLIVANKQDLRNSLSLSEIEKLLAMGELSSSTPWHLQPTCAIIGDGLKEGLEKLHDMIIKRRKMLRQQKKKR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | ARL4A ADP-ribosylation factor-like 4A [ Homo sapiens ] |
Official Symbol | ARL4A |
Synonyms | ARL4A; ADP-ribosylation factor-like 4A; ADP ribosylation factor like 4 , ARL4; ADP-ribosylation factor-like protein 4A; ADP-ribosylation factor-like 4; ARL4; |
Gene ID | 10124 |
mRNA Refseq | NM_001037164 |
Protein Refseq | NP_001032241 |
MIM | 604786 |
UniProt ID | P40617 |
◆ Recombinant Proteins | ||
Arl4a-3215M | Recombinant Mouse Arl4a, His-tagged | +Inquiry |
ARL4A-193H | Recombinant Human ARL4A protein, T7-tagged | +Inquiry |
ARL4A-2550H | Recombinant Human ARL4A protein, His-tagged | +Inquiry |
ARL4A-811H | Recombinant Human ARL4A protein, GST-tagged | +Inquiry |
ARL4A-722M | Recombinant Mouse ARL4A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARL4A-8713HCL | Recombinant Human ARL4A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARL4A Products
Required fields are marked with *
My Review for All ARL4A Products
Required fields are marked with *