Recombinant Human ARL4C Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | ARL4C-5698H |
| Product Overview : | ARL4C MS Standard C13 and N15-labeled recombinant protein (NP_005728) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | ADP-ribosylation factor-like 4C is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL4C is closely similar to ARL4A and ARL4D and each has a nuclear localization signal and an unusually high guanine nucleotide exchange rate. This protein may play a role in cholesterol transport. |
| Molecular Mass : | 21.5 kDa |
| AA Sequence : | MGNISSNISAFQSLHIVMLGLDSAGKTTVLYRLKFNEFVNTVPTIGFNTEKIKLSNGTAKGISCHFWDVGGQEKLRPLWKSYSRCTDGIIYVVDSVDVDRLEEAKTELHKVTKFAENQGTPLLVIANKQDLPKSLPVAEIEKQLALHELIPATTYHVQPACAIIGEGLTEGMDKLYEMILKRRKSLKQKKKRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | ARL4C ADP-ribosylation factor-like 4C [ Homo sapiens (human) ] |
| Official Symbol | ARL4C |
| Synonyms | ARL4C; ADP-ribosylation factor-like 4C; LAK; ARL7; ADP-ribosylation factor-like protein 4C; ADP ribosylation factor-like protein 7; ADP-ribosylation factor-like 4C; ADP-ribosylation factor-like 7; ADP-ribosylation factor-like protein LAK |
| Gene ID | 10123 |
| mRNA Refseq | NM_005737 |
| Protein Refseq | NP_005728 |
| MIM | 604787 |
| UniProt ID | P56559 |
| ◆ Recombinant Proteins | ||
| ARL4C-1106HF | Recombinant Full Length Human ARL4C Protein, GST-tagged | +Inquiry |
| ARL4C-5698H | Recombinant Human ARL4C Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Arl4c-3216M | Recombinant Mouse Arl4c, His-tagged | +Inquiry |
| ARL4C-9858H | Recombinant Human ARL4C, GST-tagged | +Inquiry |
| ARL4C-812H | Recombinant Human ARL4C protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ARL4C-8712HCL | Recombinant Human ARL4C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARL4C Products
Required fields are marked with *
My Review for All ARL4C Products
Required fields are marked with *
