Recombinant Human ARL5 protein, GST-tagged
| Cat.No. : | ARL5-814H |
| Product Overview : | Human ARL5 full-length ORF ( AAH01254, 1 a.a. - 179 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene belongs to the ARF family of GTP-binding proteins. With its distinctive nuclear/nucleolar localization and interaction with HP1alpha, the protein is developmentally regulated and may play a role(s) in nuclear dynamics and/or signaling cascades during embryonic development. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene has multiple pseudogenes. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 45.43 kDa |
| AA Sequence : | MGILFTRIWRLFNHQEHKVIIVGLDNAGKTTILYQFSMNEVVHTSPTIGSNVEEIVINNTRFLMWDIGGQESLRSSWNTYYTNTEFVIVVVDSTDRERISVTREELYKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQACCALTGEGLCQGLEWMMSRLKIR |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ARL5A ADP-ribosylation factor-like 5A [ Homo sapiens ] |
| Official Symbol | ARL5A |
| Synonyms | ARL5A; ADP-ribosylation factor-like 5A; ADP ribosylation factor like 5 , ARL5; ADP-ribosylation factor-like protein 5A; ADP-ribosylation factor-like 5; ADP-ribosylation factor-like protein 5; ARL5; ARFLP5; |
| Gene ID | 26225 |
| mRNA Refseq | NM_001037174 |
| Protein Refseq | NP_001032251 |
| MIM | 608960 |
| UniProt ID | Q9Y689 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARL5A Products
Required fields are marked with *
My Review for All ARL5A Products
Required fields are marked with *



