Recombinant Human ARL5A Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | ARL5A-4878H |
| Product Overview : | ARL5A MS Standard C13 and N15-labeled recombinant protein (NP_036229) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | The protein encoded by this gene belongs to the ARF family of GTP-binding proteins. With its distinctive nuclear/nucleolar localization and interaction with HP1alpha, the protein is developmentally regulated and may play a role(s) in nuclear dynamics and/or signaling cascades during embryonic development. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene has multiple pseudogenes. |
| Molecular Mass : | 20.7 kDa |
| AA Sequence : | MGILFTRIWRLFNHQEHKVIIVGLDNAGKTTILYQFSMNEVVHTSPTIGSNVEEIVINNTRFLMWDIGGQESLRSSWNTYYTNTEFVIVVVDSTDRERISVTREELYKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQACCALTGEGLCQGLEWMMSRLKIRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | ARL5A ADP-ribosylation factor-like 5A [ Homo sapiens (human) ] |
| Official Symbol | ARL5A |
| Synonyms | ARL5A; ADP-ribosylation factor-like 5A; ADP ribosylation factor like 5, ARL5; ADP-ribosylation factor-like protein 5A; ADP-ribosylation factor-like 5; ADP-ribosylation factor-like protein 5; ARL5; ARFLP5; |
| Gene ID | 26225 |
| mRNA Refseq | NM_012097 |
| Protein Refseq | NP_036229 |
| MIM | 608960 |
| UniProt ID | Q9Y689 |
| ◆ Recombinant Proteins | ||
| ARL5A-784R | Recombinant Rat ARL5A Protein | +Inquiry |
| ARL5A-938H | Recombinant Human ADP-ribosylation Factor-like 5A, His-tagged | +Inquiry |
| ARL5A-3819H | Recombinant Human ARL5A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Arl5a-1708M | Recombinant Mouse Arl5a Protein, Myc/DDK-tagged | +Inquiry |
| ARL5A-1196HF | Recombinant Full Length Human ARL5A Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ARL5A-8710HCL | Recombinant Human ARL5A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARL5A Products
Required fields are marked with *
My Review for All ARL5A Products
Required fields are marked with *
