Recombinant Human ARL5A Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ARL5A-3819H
Product Overview : ARL5A MS Standard C13 and N15-labeled recombinant protein (NP_001032251) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene belongs to the ARF family of GTP-binding proteins. With its distinctive nuclear/nucleolar localization and interaction with HP1alpha, the protein is developmentally regulated and may play a role(s) in nuclear dynamics and/or signaling cascades during embryonic development. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene has multiple pseudogenes.
Molecular Mass : 20.73 kDa
AA Sequence : MGILFTRIWRLFNHQEHKVIIVGLDNAGKTTILYQFSMNEVVHTSPTIGSNVEEIVINNTRFLMWDIGGQESLRSSWNTYYTNTEFVIVVVDSTDRERISVTREELYKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQACCALTGEGLCQGLEWMMSRLKIRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ARL5A ADP-ribosylation factor-like 5A [ Homo sapiens (human) ]
Official Symbol ARL5A
Synonyms ARL5A; ADP-ribosylation factor-like 5A; ADP ribosylation factor like 5, ARL5; ADP-ribosylation factor-like protein 5A; ADP-ribosylation factor-like 5; ADP-ribosylation factor-like protein 5; ARL5; ARFLP5;
Gene ID 26225
mRNA Refseq NM_001037174
Protein Refseq NP_001032251
MIM 608960
UniProt ID Q9Y689

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARL5A Products

Required fields are marked with *

My Review for All ARL5A Products

Required fields are marked with *

0
cart-icon
0
compare icon