Recombinant Human ARL6IP2 protein, GST-tagged

Cat.No. : ARL6IP2-818H
Product Overview : Human ARL6IP2 full-length ORF ( AAH53508, 1 a.a. - 412 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ATL2 (Atlastin GTPase 2) is a Protein Coding gene. Diseases associated with ATL2 include Spastic Paraplegia 3A. GO annotations related to this gene include identical protein binding and GTPase activity. An important paralog of this gene is ATL1.
Molecular Mass : 71.06 kDa
AA Sequence : MDTQGAFDSQSTIKDCATVFALSTMTSSVQVYNLSQNIQEDDLQHLQLFTEYGRLAMEEIYQKPFQTLMFLIRDWSYPYEHSYGLEGGKQFLEKRLQVKQNQHEELQNVRKHIHNCFSNLGCFLLPHPGLKVATNPSFDGRLKDIDEDFKRELRNLVPLLLAPENLVEKEISGSKVTCRDLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVAGARDTYCKSMEQVCGGDKPYIAPSDLERKHLDLKEVAIKQFRSVKKMGGDEFCRRYQDQLEAEIEETYANFIKHNDGKNIFYAARTPATLFAVMFAMYIISGLTGFIGLNSIAVLCNLVMGLALIFLCTWAYVKYSGEFREIGTVIDQIAETLWEQVLKPLGDNLMEENIRQSVTNSIKAGLTDQVSHHARLKTD
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ATL2 atlastin GTPase 2 [ Homo sapiens (human) ]
Official Symbol ATL2
Synonyms ATL2; atlastin GTPase 2; aip-2; ARL3IP2; ARL6IP2; atlastin2; atlastin-2; ADP-ribosylation factor-like protein 6-interacting protein 2; ARL-6-interacting protein 2; EC 3.6.5.-
Gene ID 64225
mRNA Refseq NM_001135673
Protein Refseq NP_001129145
MIM 609368
UniProt ID Q8NHH9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATL2 Products

Required fields are marked with *

My Review for All ATL2 Products

Required fields are marked with *

0
cart-icon
0
compare icon