Recombinant Human ARL6IP2 protein, GST-tagged
Cat.No. : | ARL6IP2-818H |
Product Overview : | Human ARL6IP2 full-length ORF ( AAH53508, 1 a.a. - 412 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ATL2 (Atlastin GTPase 2) is a Protein Coding gene. Diseases associated with ATL2 include Spastic Paraplegia 3A. GO annotations related to this gene include identical protein binding and GTPase activity. An important paralog of this gene is ATL1. |
Molecular Mass : | 71.06 kDa |
AA Sequence : | MDTQGAFDSQSTIKDCATVFALSTMTSSVQVYNLSQNIQEDDLQHLQLFTEYGRLAMEEIYQKPFQTLMFLIRDWSYPYEHSYGLEGGKQFLEKRLQVKQNQHEELQNVRKHIHNCFSNLGCFLLPHPGLKVATNPSFDGRLKDIDEDFKRELRNLVPLLLAPENLVEKEISGSKVTCRDLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVAGARDTYCKSMEQVCGGDKPYIAPSDLERKHLDLKEVAIKQFRSVKKMGGDEFCRRYQDQLEAEIEETYANFIKHNDGKNIFYAARTPATLFAVMFAMYIISGLTGFIGLNSIAVLCNLVMGLALIFLCTWAYVKYSGEFREIGTVIDQIAETLWEQVLKPLGDNLMEENIRQSVTNSIKAGLTDQVSHHARLKTD |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ATL2 atlastin GTPase 2 [ Homo sapiens (human) ] |
Official Symbol | ATL2 |
Synonyms | ATL2; atlastin GTPase 2; aip-2; ARL3IP2; ARL6IP2; atlastin2; atlastin-2; ADP-ribosylation factor-like protein 6-interacting protein 2; ARL-6-interacting protein 2; EC 3.6.5.- |
Gene ID | 64225 |
mRNA Refseq | NM_001135673 |
Protein Refseq | NP_001129145 |
MIM | 609368 |
UniProt ID | Q8NHH9 |
◆ Recombinant Proteins | ||
ATL2-9985H | Recombinant Human ATL2, GST-tagged | +Inquiry |
ATL2-70C | Recombinant Cynomolgus Monkey ATL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ATL2-6089Z | Recombinant Zebrafish ATL2 | +Inquiry |
ATL2-1268HF | Recombinant Full Length Human ATL2 Protein, GST-tagged | +Inquiry |
RFL3185HF | Recombinant Full Length Human Atlastin-2(Atl2) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATL2-122HCL | Recombinant Human ATL2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATL2 Products
Required fields are marked with *
My Review for All ATL2 Products
Required fields are marked with *