Recombinant Human ARL6IP5 protein, GST-tagged

• Cat.No.: ARL6IP5-9863H
• Product Overview: Recombinant Human ARL6IP5 protein(1-188 aa), fused with GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-188 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: MDVNIAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISIVGFLSPFNMILGGIVVVLVFTGFVWAAHNKDVLRRMKKRYPTTFVMVVMLASYFLISMFGGVMVFVFGITFPLLLMFIHASLRLRNLKNKLENKMEGIGLKRTPMGIVLDALEQQEEGINRLTDYISKVKE
• Purity: 75%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
• Publications:
  ARL6IP5 reduces cisplatin-resistance by suppressing DNA repair and promoting apoptosis pathways in ovarian carcinoma (2022)

Gene Information

• Gene Name: ARL6IP5 ADP-ribosylation-like factor 6 interacting protein 5 [ Homo sapiens ]
• Official Symbol: ARL6IP5
• Synonyms: ARL6IP5; ADP-ribosylation-like factor 6 interacting protein 5; PRA1 family protein 3; DERP11; GTRAP3 18; HSPC127; JWA; PRA1 domain family 3; PRAF3; JM5; aip-5; protein JWa; ARL-6-interacting protein 5; dermal papilla derived protein 11; dermal papilla-derived protein 11; prenylated Rab acceptor protein 2; putative MAPK activating protein PM27; putative MAPK-activating protein PM27; glutamate transporter EEAC1-associated protein; glutamate transporter EAAC1-interacting protein; cytoskeleton related vitamin A responsive protein; cytoskeleton-related vitamin A-responsive protein; ADP-ribosylation factor-like protein 6-interacting protein 5; jmx; hp22; addicsin; GTRAP3-18
• Gene ID: 10550
• mRNA Refseq: NM_006407
• Protein Refseq: NP_006398
• MIM: 605709
• UniProt ID: O75915

Citation

ARL6IP5 reduces cisplatin-resistance by suppressing DNA repair and promoting apoptosis pathways in ovarian carcinoma

Journal: Cell Death & Disease    PubMed ID: 35293383    Data: 2022/3/15

Authors: Ji-Ye Kim, Entaz Bahar, Hyun-Soo Kim

Article Snippet:rARL6IP5 (#ARL6IP5–9863H; Creative BioMart, NY, USA) is a full-length human ARL6IP5 protein, with a length of 1?188 amino acids and was fused with a glutathione S-transferase-tag at N-terminus.. According to the manufacturer’s information sheet, the protein was produced from E.coli transfection and purified by glutathione-sepharose. rARL6IP5 was added to the culture media for experiments.According to the manufacturer’s information sheet, the protein was produced from E.coli transfection and purified by glutathione-sepharose. rARL6IP5 was added to the culture media for experiments.

A Representative photomicrographs showing ARL6IP5 immunoreactivity (original magnification, ×20; scale bar, 100 μm). Kaplan–Meier plots for B PFS and C OS in 79 patients with ovarian HGSC.

Prognostic significance of ARL6IP5 expression and clinicopathological characteristics in ovarian high-grade serous carcinoma patients.

ARL6IP5, XRCC1, and PARP1 expression was analyzed by western blots in 8 OC cell lines, ES-2, OV-90, TOV21sG, CaOV-4, CaOV-3, TOV112D, SKOV3, OVCAR-3, and one normal ovarian cell line, Hs823.Tc.