Recombinant Human ARL6IP5 protein, GST-tagged
Cat.No. : | ARL6IP5-9863H |
Product Overview : | Recombinant Human ARL6IP5 protein(1-188 aa), fused with GST tag, was expressed in E.coli. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Citation
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-188 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MDVNIAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISIVGFLSPFNMILGGIVVVLVFTGFVWAAHNKDVLRRMKKRYPTTFVMVVMLASYFLISMFGGVMVFVFGITFPLLLMFIHASLRLRNLKNKLENKMEGIGLKRTPMGIVLDALEQQEEGINRLTDYISKVKE |
Purity : | 75%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Publications : |
ARL6IP5 reduces cisplatin-resistance by suppressing DNA repair and promoting apoptosis pathways in ovarian carcinoma (2022)
|
Gene Name | ARL6IP5 ADP-ribosylation-like factor 6 interacting protein 5 [ Homo sapiens ] |
Official Symbol | ARL6IP5 |
Synonyms | ARL6IP5; ADP-ribosylation-like factor 6 interacting protein 5; PRA1 family protein 3; DERP11; GTRAP3 18; HSPC127; JWA; PRA1 domain family 3; PRAF3; JM5; aip-5; protein JWa; ARL-6-interacting protein 5; dermal papilla derived protein 11; dermal papilla-derived protein 11; prenylated Rab acceptor protein 2; putative MAPK activating protein PM27; putative MAPK-activating protein PM27; glutamate transporter EEAC1-associated protein; glutamate transporter EAAC1-interacting protein; cytoskeleton related vitamin A responsive protein; cytoskeleton-related vitamin A-responsive protein; ADP-ribosylation factor-like protein 6-interacting protein 5; jmx; hp22; addicsin; GTRAP3-18; |
Gene ID | 10550 |
mRNA Refseq | NM_006407 |
Protein Refseq | NP_006398 |
MIM | 605709 |
UniProt ID | O75915 |
◆ Cell & Tissue Lysates | ||
ARL6IP5-36HCL | Recombinant Human ARL6IP5 lysate | +Inquiry |
ARL6IP5 reduces cisplatin-resistance by suppressing DNA repair and promoting apoptosis pathways in ovarian carcinoma
Journal: Cell Death & Disease PubMed ID: 35293383 Data: 2022/3/15
Authors: Ji-Ye Kim, Entaz Bahar, Hyun-Soo Kim
Article Snippet:rARL6IP5 (#ARL6IP5–9863H; Creative BioMart, NY, USA) is a full-length human ARL6IP5 protein, with a length of 1?188 amino acids and was fused with a glutathione S-transferase-tag at N-terminus.. According to the manufacturer’s information sheet, the protein was produced from E.coli transfection and purified by glutathione-sepharose. rARL6IP5 was added to the culture media for experiments.According to the manufacturer’s information sheet, the protein was produced from E.coli transfection and purified by glutathione-sepharose. rARL6IP5 was added to the culture media for experiments.

A Representative photomicrographs showing

Prognostic significance of

Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARL6IP5 Products
Required fields are marked with *
My Review for All ARL6IP5 Products
Required fields are marked with *