Recombinant Human ARL6IP5 protein, GST-tagged
Cat.No. : | ARL6IP5-820H |
Product Overview : | Human ARL6IP5 partial ORF ( NP_006398, 1 a.a. - 64 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Expression of this gene is affected by vitamin A. The encoded protein of this gene may be associated with the cytoskeleton. A similar protein in rats may play a role in the regulation of cell differentiation. The rat protein binds and inhibits the cell membrane glutamate transporter EAAC1. The expression of the rat gene is upregulated by retinoic acid, which results in a specific reduction in EAAC1-mediated glutamate transport. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 32.78 kDa |
AA Sequence : | MDVNIAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISIVGFLSPF |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ARL6IP5 ADP-ribosylation-like factor 6 interacting protein 5 [ Homo sapiens ] |
Official Symbol | ARL6IP5 |
Synonyms | ARL6IP5; ADP-ribosylation-like factor 6 interacting protein 5; PRA1 family protein 3; DERP11; GTRAP3 18; HSPC127; JWA; PRA1 domain family 3; PRAF3; JM5; aip-5; protein JWa; ARL-6-interacting protein 5; dermal papilla derived protein 11; dermal papilla-derived protein 11; prenylated Rab acceptor protein 2; putative MAPK activating protein PM27; putative MAPK-activating protein PM27; glutamate transporter EEAC1-associated protein; glutamate transporter EAAC1-interacting protein; cytoskeleton related vitamin A responsive protein; cytoskeleton-related vitamin A-responsive protein; ADP-ribosylation factor-like protein 6-interacting protein 5; jmx; hp22; addicsin; GTRAP3-18; |
Gene ID | 10550 |
mRNA Refseq | NM_006407 |
Protein Refseq | NP_006398 |
MIM | 605709 |
UniProt ID | O75915 |
◆ Recombinant Proteins | ||
RFL420BF | Recombinant Full Length Bovine Pra1 Family Protein 3(Arl6Ip5) Protein, His-Tagged | +Inquiry |
ARL6IP5-1975C | Recombinant Chicken ARL6IP5 | +Inquiry |
ARL6IP5-820H | Recombinant Human ARL6IP5 protein, GST-tagged | +Inquiry |
RFL12644MF | Recombinant Full Length Mouse Pra1 Family Protein 3(Arl6Ip5) Protein, His-Tagged | +Inquiry |
ARL6IP5-728M | Recombinant Mouse ARL6IP5 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARL6IP5-36HCL | Recombinant Human ARL6IP5 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARL6IP5 Products
Required fields are marked with *
My Review for All ARL6IP5 Products
Required fields are marked with *