Recombinant Human ARL9 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ARL9-3716H |
Product Overview : | ARL9 MS Standard C13 and N15-labeled recombinant protein (NP_996802) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | ARL9 is a member of the small GTPase protein family with a high degree of similarity to ARF proteins of the RAS superfamily. |
Molecular Mass : | 13.6 kDa |
AA Sequence : | MEFLEIGGSKPFRSYWEMYLSKGLLLIFVVDSADHSRLPEAKKYLHQLIAANPVLPLVVFANKQDLEAAYHITDIHEALALSEVGNDRKMFLFGTYLTKNGSEIPSTMQDAKDLIAQLAADVQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ARL9 ADP-ribosylation factor-like 9 [ Homo sapiens (human) ] |
Official Symbol | ARL9 |
Synonyms | ARL9; ADP-ribosylation factor-like 9; ADP-ribosylation factor-like protein 9; ADP-ribosylation factor-like 9 |
Gene ID | 132946 |
mRNA Refseq | NM_206919 |
Protein Refseq | NP_996802 |
MIM | 612405 |
UniProt ID | Q6T311 |
◆ Recombinant Proteins | ||
ARL9-2796H | Recombinant Human ARL9 Protein, MYC/DDK-tagged | +Inquiry |
ARL9-1337H | Recombinant Human ADP-Ribosylation Factor-Like 9, His-tagged | +Inquiry |
ARL9-824H | Recombinant Human ARL9 protein, GST-tagged | +Inquiry |
ARL9-1345HF | Recombinant Full Length Human ARL9 Protein, GST-tagged | +Inquiry |
ARL9-4356Z | Recombinant Zebrafish ARL9 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARL9-124HCL | Recombinant Human ARL9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARL9 Products
Required fields are marked with *
My Review for All ARL9 Products
Required fields are marked with *