Recombinant Human ARL9 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ARL9-3716H
Product Overview : ARL9 MS Standard C13 and N15-labeled recombinant protein (NP_996802) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : ARL9 is a member of the small GTPase protein family with a high degree of similarity to ARF proteins of the RAS superfamily.
Molecular Mass : 13.6 kDa
AA Sequence : MEFLEIGGSKPFRSYWEMYLSKGLLLIFVVDSADHSRLPEAKKYLHQLIAANPVLPLVVFANKQDLEAAYHITDIHEALALSEVGNDRKMFLFGTYLTKNGSEIPSTMQDAKDLIAQLAADVQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ARL9 ADP-ribosylation factor-like 9 [ Homo sapiens (human) ]
Official Symbol ARL9
Synonyms ARL9; ADP-ribosylation factor-like 9; ADP-ribosylation factor-like protein 9; ADP-ribosylation factor-like 9
Gene ID 132946
mRNA Refseq NM_206919
Protein Refseq NP_996802
MIM 612405
UniProt ID Q6T311

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARL9 Products

Required fields are marked with *

My Review for All ARL9 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon