Recombinant Human ARMC8 protein, His-tagged
Cat.No. : | ARMC8-3333H |
Product Overview : | Recombinant Human ARMC8 protein(1-350 aa), fused to His tag, was expressed in E. coli. |
Availability | September 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-350 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MEVTASSRHYVDRLFDPDPQKVLQGVIDMKNAVIGNNKQKANLIVLGAVPRLLYLLQQETSSTELKTECAVVLGSLAMGTENNVKSLLDCHIIPALLQGLLSPDLKFIEACLRCLRTIFTSPVTPEELLYTDATVIPHLMALLSRSRYTQEYICQIFSHCCKGPDHQTILFNHGAVQNIAHLLTSLSYKVRMQALKCFSVLAFENPQVSMTLVNVLVDGELLPQIFVKMLQRDKPIEMQLTSAKCLTYMCRAGAIRTDDNCIVLKTLPCLVRMCSKERLLEERVEGAETLAYLIEPDVELQRIASITDHLIAMLADYFKYPSSVSAITDIKRLDHDLKHAHELRQAAFKL |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ARMC8 armadillo repeat containing 8 [ Homo sapiens ] |
Official Symbol | ARMC8 |
Synonyms | ARMC8; armadillo repeat containing 8; armadillo repeat-containing protein 8; DKFZP434A043; HSPC056; S863-2; MGC4880; MGC10058; |
Gene ID | 25852 |
mRNA Refseq | NM_014154 |
Protein Refseq | NP_054873 |
UniProt ID | Q8IUR7 |
◆ Recombinant Proteins | ||
ARMC8-1318H | Recombinant Human ARMC8 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ARMC8-409R | Recombinant Rhesus monkey ARMC8 Protein, His-tagged | +Inquiry |
ARMC8-4891Z | Recombinant Zebrafish ARMC8 | +Inquiry |
ARMC8-238R | Recombinant Rhesus Macaque ARMC8 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARMC8-1177HF | Recombinant Full Length Human ARMC8 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARMC8-8697HCL | Recombinant Human ARMC8 293 Cell Lysate | +Inquiry |
ARMC8-8699HCL | Recombinant Human ARMC8 293 Cell Lysate | +Inquiry |
ARMC8-8698HCL | Recombinant Human ARMC8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARMC8 Products
Required fields are marked with *
My Review for All ARMC8 Products
Required fields are marked with *