Recombinant Human ARMC8 protein, His-tagged
| Cat.No. : | ARMC8-3333H |
| Product Overview : | Recombinant Human ARMC8 protein(1-350 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 22, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-350 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MEVTASSRHYVDRLFDPDPQKVLQGVIDMKNAVIGNNKQKANLIVLGAVPRLLYLLQQETSSTELKTECAVVLGSLAMGTENNVKSLLDCHIIPALLQGLLSPDLKFIEACLRCLRTIFTSPVTPEELLYTDATVIPHLMALLSRSRYTQEYICQIFSHCCKGPDHQTILFNHGAVQNIAHLLTSLSYKVRMQALKCFSVLAFENPQVSMTLVNVLVDGELLPQIFVKMLQRDKPIEMQLTSAKCLTYMCRAGAIRTDDNCIVLKTLPCLVRMCSKERLLEERVEGAETLAYLIEPDVELQRIASITDHLIAMLADYFKYPSSVSAITDIKRLDHDLKHAHELRQAAFKL |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | ARMC8 armadillo repeat containing 8 [ Homo sapiens ] |
| Official Symbol | ARMC8 |
| Synonyms | ARMC8; armadillo repeat containing 8; armadillo repeat-containing protein 8; DKFZP434A043; HSPC056; S863-2; MGC4880; MGC10058; |
| Gene ID | 25852 |
| mRNA Refseq | NM_014154 |
| Protein Refseq | NP_054873 |
| UniProt ID | Q8IUR7 |
| ◆ Recombinant Proteins | ||
| ARMC8-738M | Recombinant Mouse ARMC8 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ARMC8-4557C | Recombinant Chicken ARMC8 | +Inquiry |
| ARMC8-238R | Recombinant Rhesus Macaque ARMC8 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ARMC8-1177HF | Recombinant Full Length Human ARMC8 Protein, GST-tagged | +Inquiry |
| ARMC8-4891Z | Recombinant Zebrafish ARMC8 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ARMC8-8699HCL | Recombinant Human ARMC8 293 Cell Lysate | +Inquiry |
| ARMC8-8697HCL | Recombinant Human ARMC8 293 Cell Lysate | +Inquiry |
| ARMC8-8698HCL | Recombinant Human ARMC8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARMC8 Products
Required fields are marked with *
My Review for All ARMC8 Products
Required fields are marked with *
